(data stored in ACNUC7421 zone)

EMBL: CR954246.PE252

CR954246.PE252       Location/Qualifiers
FT   CDS_pept        280312..280788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0267"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85366"
FT                   /db_xref="GOA:Q3IDU1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDU1"
FT                   /protein_id="CAI85366.1"
FT                   /translation="MSRSFKSHLSDDIATVTMGNRIAAIIEQGAVIYLHGDLGAGKTTF
FT                   TRGIVQGFGHTGKVKSPTYTLVEPYELERANVYHFDLYRLGDPEELEYMGIRDYFSAQA
FT                   ICVVEWPEKGGEFIPVPDLNITLSYVGDERNIVINSASERGSVIIEKLNNLTSE"
     atgtcacgta gttttaagtc tcacttgagt gatgatattg ccacggtaac aatgggcaat        60
     cgaattgcgg ctattataga gcaaggtgcg gtaatttatt tacatggcga tttaggcgcg       120
     ggtaaaacca cctttacacg tggcatagtg caaggttttg gccatacagg taaggttaaa       180
     agtccaacgt ataccttagt agagccatat gagctggagc gcgctaatgt ttaccacttt       240
     gatttgtatc gtttaggcga tccagaagaa cttgaatata tgggaatacg cgattacttt       300
     tcagcgcaag caatttgtgt ggttgaatgg ccagaaaaag gcggagagtt tattcctgtg       360
     ccagatttaa atattacctt aagctatgta ggcgatgagc gaaatatcgt tattaatagt       420
     gccagtgagc gtggtagcgt aattattgaa aaactaaata acttaacctc agagtaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page