(data stored in ACNUC7421 zone)

EMBL: CR954246.PE261

CR954246.PE261       Location/Qualifiers
FT   CDS_pept        290672..291310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0276"
FT                   /product="Sodium-type polar flagellar protein motX"
FT                   /function="1.5.3 : Motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85375"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ2"
FT                   /protein_id="CAI85375.1"
FT                   /translation="MQLLFSHSVLLLPLMTLSLLMSSNSLAEETAAAVPLYTETELISL
FT                   INKNTHLARVKADDCQLVQDIEARANKMALPSYQFLYGDMLAYNVCVDRDVELGVYYMQ
FT                   KAAEQGLAAALEQLGRYYDIGRLVQQDKAMAITYLREASSQGNLKAQFRLVKLFNQGYG
FT                   SPRDFEDMYRWLFYAKVADANTHKKIERLLAQLAEKMPASVVARARLPM"
     atgcagttac tttttagtca ttcagttttg ttattaccat taatgacact ctctttattg        60
     atgagcagca atagcttagc agaagaaacg gcagcagcag tgccactgta tactgagact       120
     gagttaattt cgctaattaa taaaaacacc catttagccc gggttaaggc agatgattgc       180
     cagttagtac aagatataga agcgcgagcc aataaaatgg cattaccatc gtatcagttt       240
     ttatatggcg atatgctagc ctataacgta tgtgttgatc gcgatgtaga gttaggtgtg       300
     tactatatgc aaaaagcggc tgagcagggc ttagcagcgg ctttagagca gttagggcgt       360
     tactacgaca ttgggcgttt ggtacaacaa gataaagcaa tggcaatcac ttatttgcgt       420
     gaagcgtcat cgcagggaaa tttaaaagcg cagtttcgct tagttaagtt atttaaccaa       480
     ggctacggca gtccacgcga ctttgaagat atgtatcgtt ggttatttta tgccaaggtt       540
     gcagatgcca atacacataa aaaaattgag cgcttattag ctcagttagc cgaaaaaatg       600
     ccagccagcg ttgtggctcg tgctcgccta cctatgtaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page