(data stored in ACNUC7421 zone)

EMBL: CR954246.PE266

CR954246.PE266       Location/Qualifiers
FT   CDS_pept        296932..297318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0281"
FT                   /product="putative orphan protein ; putative signal
FT                   peptide"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85380"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY6"
FT                   /protein_id="CAI85380.1"
FT                   /translation="MKKYALVLMVLLVGCANSSDEQPYEINNKQFHEKQDEQGNKLFAY
FT                   VVSVKAKSRQNINLDKKFTRSDFERFAAQEHFEESSILKLQLEDQAVELLNKELETRNY
FT                   CPAKHEINEVLWRDLSVQLRGRCL"
     atgaaaaagt atgccttagt actgatggtt ttgcttgttg gctgtgctaa ctcaagtgac        60
     gagcaacctt atgaaataaa taataaacag tttcatgaaa aacaagatga acaaggaaat       120
     aagctatttg cctacgtagt atcggtaaag gctaaaagcc gccagaacat taatttagat       180
     aaaaagttta cccgcagtga ctttgagcgt tttgcagcgc aagagcattt tgaagagtcg       240
     agtattttaa aattgcagtt agaagatcaa gctgttgaat tgttaaataa agagcttgaa       300
     acacgcaact attgccccgc taagcatgaa attaatgagg tactgtggcg tgatttaagt       360
     gtgcaattaa gaggacgttg tttgtag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page