(data stored in ACNUC7421 zone)

EMBL: CR954246.PE267

CR954246.PE267       Location/Qualifiers
FT   CDS_pept        297320..297820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0282"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85381"
FT                   /db_xref="GOA:Q3IEY5"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY5"
FT                   /protein_id="CAI85381.1"
FT                   /translation="MLADKTKLAALLAQLNINYEVIEHPPLHGSLDADAFMVERPGTRL
FT                   KNLFLRDNEGKRHFLVITAHDKQLDLKVLSKQQGLSRLGFASSERLARYLKVAPGCVSM
FT                   LSLMNDKQNEVSVWLDQDIWQGELFHCHPFENTQTWLLNKADLEQFFNFTEHQPRVVFL
FT                   PSR"
     atgttagctg ataaaacaaa gttagcagcg ctattagcgc agttaaatat taattatgag        60
     gtgatagagc acccaccatt acatggcagt ttagatgccg atgcctttat ggtggagcgc       120
     ccaggtacac gacttaaaaa tttattttta cgtgataatg aaggtaagcg gcacttttta       180
     gttataaccg cccatgacaa gcaacttgat ttaaaagtat tgtcaaaaca acaagggtta       240
     tcgcggttag gatttgcctc aagcgagcgt ttagcgcgct atttaaaagt agcacctggg       300
     tgtgtatcta tgcttagcct aatgaacgac aagcaaaacg aagtaagcgt ttggctagat       360
     caagatattt ggcaaggtga gctatttcat tgtcatccgt ttgaaaacac ccaaacctgg       420
     ttacttaata aagcagactt agagcagttt tttaacttta ctgagcatca gcctcgcgta       480
     gtatttttac cttcaaggta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page