(data stored in ACNUC7421 zone)

EMBL: CR954246.PE268

CR954246.PE268       Location/Qualifiers
FT   CDS_pept        complement(297787..298935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0283"
FT                   /product="putative transport protein (MFS family)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85382"
FT                   /db_xref="GOA:Q3IEY4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY4"
FT                   /protein_id="CAI85382.1"
FT                   /translation="MRLPHLLLCSVFIFFVLYAPQPLLGLFAVEFGVAPAAAGSLMTAA
FT                   MLPLAIAPLVYGLFLTKRNPLFILRIAMLLLGGCCLLFVYAPTFELLLLVRFLQGLILP
FT                   AALTAMTSYIGMSFSADTLQKNMTIYIGSTIVGGYFGRVLAAIFSDIWHWQSFYYFIAT
FT                   MLILLAWSIPHTRFKSNNVKSILSPLDYIKQLREGPLLKVYGAVFCMFFCFAALLNYLP
FT                   FILQNTFLITNTRDIGLVYSGYLIGALASITTPWLLKKVPSAWHLLTAIFLFYSISIVM
FT                   LMSHQLIVFLAAFTLFCGSMFVIHSTAAPLVNKISKAPPSVTNGGYVSFYYSGGALGSL
FT                   LPGVIYQHHGQTAFMAALLAVCLCGLMLVIWAYLEGKNTTRG"
     atgcgcctac ctcacttgtt gctttgctct gtatttattt tttttgtact ttacgctcca        60
     caaccactgc ttggcctatt tgcagttgag tttggtgttg cccccgccgc tgctggcagc       120
     ttaatgactg cggctatgct accactggct attgcgcctt tagtgtatgg gttgttttta       180
     actaaacgta atcctttatt tatattacgc attgctatgt tgttattggg aggatgctgt       240
     ttattatttg tttacgcccc cacctttgag ctgctgttat tggtacgctt tttacaaggc       300
     ctaatattac cagcggcatt aacagccatg accagttata ttggcatgag ttttagtgcc       360
     gatacactgc aaaaaaatat gacaatctac attggcagca ccatagtagg cggctatttt       420
     gggcgtgttc tggcagctat ttttagcgat atatggcact ggcaaagctt ttattatttt       480
     attgccacca tgctcatttt gcttgcgtgg agtattcccc atacccgctt taaaagtaat       540
     aacgttaaat caatactttc accactagac tatattaaac aactgcgtga agggccgctg       600
     ctaaaagtgt atggtgcggt attttgtatg tttttttgct ttgccgcttt acttaattat       660
     ttacctttta ttttgcaaaa tactttttta atcactaata ctcgcgacat tggcttggtt       720
     tacagtggtt atttaatcgg cgctttagcg tctattacaa caccttggtt acttaaaaaa       780
     gtgccctctg catggcattt attaacggct atatttttgt tttacagtat tagcattgtc       840
     atgttaatga gccaccagct aatagtgttt ttagccgcat ttacattatt ttgcgggtct       900
     atgtttgtga ttcactcaac tgccgctccc ttagttaata aaataagtaa agcaccacca       960
     agtgttacta atggcgggta tgtatcgttt tattacagcg gcggtgcact tgggtcgtta      1020
     ttaccagggg tgatatacca gcatcatggg caaaccgcat ttatggcagc tttattggct      1080
     gtttgcctat gcggcttgat gctggttata tgggcttacc ttgaaggtaa aaatactacg      1140
     cgaggctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page