(data stored in ACNUC7421 zone)

EMBL: CR954246.PE269

CR954246.PE269       Location/Qualifiers
FT   CDS_pept        299201..299740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0284"
FT                   /product="conserved protein of unknown function ; putative
FT                   nucleoprotein/polynucleotide-associated enzyme"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85383"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY3"
FT                   /protein_id="CAI85383.1"
FT                   /translation="MGSLQEQLLQAGLTTSHKAKVAKSEKRKQQKKQKKGATSNPSDLQ
FT                   KHIQQTKLEQQQKAEELNQARQGSLKQREQSARVKQILEHHNQEAIRGERTFNFTYENK
FT                   VKSIEVNERTQKALSGGRLAICVLEGRFYVLEDEPARKVAEVDEHYIVFHVEPESKVKD
FT                   EDDPYADFEIPDDLTW"
     atggggtcac ttcaagagca attgctccaa gcaggattaa caacatcgca taaagctaaa        60
     gttgctaaat cagaaaagcg taagcagcaa aaaaagcaaa aaaagggtgc aaccagtaac       120
     cctagcgatt tacaaaagca tattcaacaa acaaaacttg agcagcaaca aaaagcagaa       180
     gagcttaacc aggcacgcca aggtagttta aagcagcgcg agcaaagtgc ccgtgttaaa       240
     caaattttag aacaccataa ccaagaagca atacgtggtg agcgtacttt taactttact       300
     tacgaaaaca aagtaaagag cattgaagta aacgaaagaa cgcaaaaagc gttatcgggt       360
     ggtcgcttag ctatttgtgt gctcgaaggc cgattttacg tattagaaga cgaaccggca       420
     cgtaaagtag ctgaagtaga tgaacattat attgtttttc atgttgagcc agaaagcaaa       480
     gtaaaagatg aagacgatcc atacgctgat tttgaaatac cagatgattt aacgtggtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page