(data stored in ACNUC7421 zone)

EMBL: CR954246.PE27

CR954246.PE27        Location/Qualifiers
FT   CDS_pept        30253..30828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0027"
FT                   /product="putative DNA topoisomerase; C4 zinc finger domain
FT                   protein"
FT                   /function="3.1.3 : DNA packaging and segregation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85141"
FT                   /db_xref="GOA:Q3IDH8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH8"
FT                   /protein_id="CAI85141.1"
FT                   /translation="MSKIDHSLFSANKHALEKEYEICPQCGSELVIRNSKSGPFLGCAS
FT                   YPKCDFIRPLAHHDSSEIKVLEDSACPQCSKQLVVKNGRYGMFIGCTGYPECHYIANEN
FT                   EAKQNEEPLPSCPKCKKGRLVSRSNKFGKIFYSCDCYPSCKYTLNNKPVEQSCPECNWP
FT                   LLIERKMANSTVLQCPQKSCMHKLAATE"
     atgagtaaaa tcgaccattc gcttttctcg gcgaataagc acgccctaga aaaagaatat        60
     gagatatgcc cacaatgtgg ttcagagtta gtgatccgca atagtaaatc aggcccattt       120
     ttaggttgtg ccagctaccc caagtgcgat tttattcgcc cgttggcgca tcacgatagc       180
     agtgaaataa aagtgctaga agattccgca tgtccacaat gtagtaagca gctggtggta       240
     aaaaatggcc gctacggtat gtttattggt tgtacagggt atccagagtg tcattacatt       300
     gccaatgaaa acgaggcaaa gcaaaatgaa gagccattac ctagttgccc taaatgtaaa       360
     aaaggccgtt tagtttcacg tagtaataaa tttggtaaaa tattttattc atgcgattgc       420
     tacccaagct gtaaatatac gctgaataat aaaccggttg agcaatcgtg cccagaatgt       480
     aactggccac tgctgattga gagaaaaatg gctaatagca ctgtgttaca atgcccgcaa       540
     aaaagttgta tgcataaact tgcagccact gaataa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page