(data stored in ACNUC7421 zone)

EMBL: CR954246.PE270

CR954246.PE270       Location/Qualifiers
FT   CDS_pept        299916..300239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0285"
FT                   /product="putative cytochrome c4 family"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85384"
FT                   /db_xref="GOA:Q3IEY2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY2"
FT                   /protein_id="CAI85384.1"
FT                   /translation="MSKIKTLLLGAGISLAASLSFNAAAADGAALYTAKNCQTCHGAEG
FT                   KAPIMGMYPKLNGQNKDYLVAQMKDIKSGARSNGMSMAMKAMVATVTDEEFAAIADYLA
FT                   NVK"
     atgagcaaaa ttaaaacact tttattaggc gcgggtatta gtttagccgc aagcttgtca        60
     tttaatgcag ctgctgcaga tggtgctgca ctttacactg ctaaaaactg ccaaacgtgt       120
     cacggcgcag aaggtaaggc acctattatg ggcatgtacc ctaaattaaa tggtcaaaat       180
     aaagactatt tagttgcaca aatgaaagac attaaatcag gtgcgcgcag taatggtatg       240
     tctatggcta tgaaagctat ggtagcaacc gtaacagatg aagagtttgc tgcaattgct       300
     gattaccttg caaacgtaaa ataa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page