(data stored in ACNUC7421 zone)

EMBL: CR954246.PE271

CR954246.PE271       Location/Qualifiers
FT   CDS_pept        300382..301149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0286"
FT                   /product="conserved protein of unknown function ; putative
FT                   aldolase class II family"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="4.1.2.-"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85385"
FT                   /db_xref="GOA:Q3IEY1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY1"
FT                   /protein_id="CAI85385.1"
FT                   /translation="MFDLPQLDLKNKVSAQEWQLRVDLAACYRLVDHFRWGDLIYTHLS
FT                   ARIPGSDHYLVNAFGLTFDEISASNLVKVDLSGNIIDDTPFNINPAGFTIHSAIHEVRD
FT                   DAHCVIHLHTKETIAVATQKNGLLPLSQYSMFSLPSLSYHGYEGLAVNDDERKRLQDDL
FT                   GNTNHMLLVNHGGLTVGPTVGDAFMRFYDLQRACEIQLAIQASSQQAISVPQPIIDNIY
FT                   NQANVVHSGSTGGQLAWPAMLRKAYRLDPSFAK"
     atgtttgatt taccccagct cgatttaaaa aataaagtat cagcacaaga atggcagcta        60
     cgagttgatc tagcagcctg ttataggttg gtggatcatt ttcgttgggg cgatttaatt       120
     tacacgcatt tatcggcgcg gataccgggc agtgatcatt acttagtgaa cgcctttggt       180
     ttaacctttg atgaaatcag cgcttctaac ttagttaaag tagatttaag cggcaatatt       240
     attgacgaca cgccatttaa tattaatcca gctggcttta ctattcatag cgcaattcac       300
     gaagtacgcg acgatgcgca ttgtgtgatt catttgcaca cgaaagaaac catagctgtt       360
     gctacacaaa aaaatggctt attgccacta agtcagtatt ccatgttctc tttgccgtcg       420
     ctttcgtatc atggttacga agggttagcg gttaacgatg atgaacgaaa acgcttacaa       480
     gatgatttag gcaatactaa ccatatgttg ttagttaacc acggtggctt aacagtgggg       540
     ccaacggtgg gcgatgcttt tatgcgcttt tatgatttac agcgcgcctg tgaaatacag       600
     ctcgctattc aagccagttc gcagcaggct attagcgtcc cgcagcctat aatcgacaat       660
     atttataatc aagcaaatgt agtgcacagt ggtagtactg gcgggcagtt agcgtggcca       720
     gctatgctgc gcaaagcgta ccgacttgat cctagttttg caaaataa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page