(data stored in ACNUC7421 zone)

EMBL: CR954246.PE272

CR954246.PE272       Location/Qualifiers
FT   CDS_pept        301177..302352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0287"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme family"
FT                   /EC_number="5.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85386"
FT                   /db_xref="GOA:Q3IEY0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEY0"
FT                   /protein_id="CAI85386.1"
FT                   /translation="MKVNRVEVFDIHCPDRPAWTPVFVRIHTDEGISGVGEAGLAYDLG
FT                   HSAAAAMIKEMADAFLIGHDPFQTEKLWSRMLRESFWGLGGGPVVYAAMSAIDTALWDI
FT                   KGKALGVPVYQLLGGKVNDKLRTYASQLQFDWDSEFKALVQPQEYAEAALKAVAEGYDA
FT                   VKVDPIQYDKDGNTYYDRTNIISRAEMKLYRARMQAIREAVGDEVDIIFECHSLPGVTS
FT                   AIQLGEIAKEFDCMFFEEPVNYLNHSLHAKVADKVAVPIAGGERLYNRWGVRPYLEDQS
FT                   INVLQPDIGLCGGFTETKKVCDYADIFDVRIQAHVCGGPVATAASLHLETAIPNFLIHE
FT                   HHTYAIKKWNRELCLQDPQPKNGFFQVSEEPGIGIELNDEIVMRSQRVEIK"
     atgaaagtaa atcgcgttga agtgtttgat attcattgcc cagatcgtcc tgcttggact        60
     ccagtatttg tacgtattca tactgatgaa ggtattagtg gtgtgggtga agcgggcctt       120
     gcatacgatt taggccacag cgctgctgcc gctatgatca aagaaatggc cgatgcattt       180
     ttaattggcc acgacccatt tcaaaccgaa aagctttggt cgcgtatgtt acgtgaaagc       240
     ttttggggtt taggtggtgg gcctgttgta tatgctgcaa tgagtgcgat tgatactgct       300
     ctgtgggata ttaaaggtaa agcactgggt gtacctgtgt atcaactact tggtggtaag       360
     gttaacgata aattacgcac ttatgcatcg caactacagt ttgactggga tagcgagttt       420
     aaagcattag tgcagccaca agaatacgcc gaagcggctt taaaagcggt tgccgagggt       480
     tacgatgcag taaaagtaga cccaattcag tacgataaag acggcaatac ttactacgat       540
     cgcactaata ttatttcccg cgctgaaatg aagttgtacc gtgcgcgtat gcaagcgatt       600
     cgtgaagcgg taggcgacga agttgatatt atttttgaat gccatagctt accaggggtg       660
     acttcggcaa ttcaattggg cgaaatagcg aaagaattcg attgcatgtt ttttgaagaa       720
     cccgttaact atttaaacca ttcattgcat gccaaagtgg ctgataaagt ggccgtgcca       780
     attgctggtg gtgaacgctt gtataaccgc tggggtgtac gcccatactt agaagatcaa       840
     agtattaatg tattgcaacc cgatattggt ttatgtggtg gttttaccga aaccaaaaaa       900
     gtgtgtgact acgccgatat ttttgatgtg cgcattcaag cgcatgtatg cggcgggcca       960
     gtagcgactg ctgcttcact gcatttagaa acagccattc ctaacttttt aattcatgag      1020
     catcatactt atgcgattaa aaaatggaac cgtgagttgt gtctgcaaga tcctcaacct      1080
     aaaaatggct tttttcaagt gtcggaagag ccaggtattg gtattgaatt aaacgatgag      1140
     attgtaatgc gctcgcagcg tgtagaaatt aaatag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page