(data stored in ACNUC7421 zone)

EMBL: CR954246.PE273

CR954246.PE273       Location/Qualifiers
FT   CDS_pept        complement(302423..302806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0288"
FT                   /product="putative orphan protein ; putative signal
FT                   peptide"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX9"
FT                   /protein_id="CAI85387.1"
FT                   /translation="MKVRRLTVIAFITTALSGCLAQSAEPTPKLQHALLVTPNSIAVAN
FT                   AIASLLHSSQVQLADDVFTTNSTVTLDKLNHKDSMGNPIMGKQLNMPDQFELMIKGKQC
FT                   FVRHLDSKATQQLKGVQCKINQL"
     atgaaagtac gccgacttac agtaatcgca tttataacaa ccgcactcag cggctgctta        60
     gcacaaagcg ctgagccaac tcctaagctg cagcatgcgc tattagtaac acctaatagc       120
     atagcagtag ctaatgctat tgccagctta ctgcatagct cacaagtgca attagccgat       180
     gatgtattta ctactaacag tactgtgacg ctcgataaac tcaaccataa agactctatg       240
     ggcaatccta ttatgggtaa gcagcttaat atgcccgacc agtttgagtt aatgattaaa       300
     ggcaagcaat gctttgttcg ccatcttgat agcaaagcaa cgcagcagtt aaaaggcgtg       360
     cagtgtaaaa ttaatcagct ataa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page