(data stored in ACNUC7421 zone)

EMBL: CR954246.PE274

CR954246.PE274       Location/Qualifiers
FT   CDS_pept        complement(302810..304375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0289"
FT                   /product="conserved protein of unknown function ; putative
FT                   signal peptide"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85388"
FT                   /db_xref="GOA:Q3IEX8"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX8"
FT                   /protein_id="CAI85388.1"
FT                   /translation="MHSKIRDKKTTTLASLALLSVLSGCGGGSDSEGLTPNSNTNSWSA
FT                   GVFASASQFKGQCQASNEKNWLRSWSNETYLWYDEIIDTDPALTSGVVAYFNTLKTNEL
FT                   TDSGAKKDNYHFNLPTDEWQRQSQSGVTYGYGFNIKILASSAPRQAVISYTEPNTPASN
FT                   QNLARGFELVAVDGIDFVNTTSSSEVALISASLFPEQTGKTTEFVFKDINTNQNRTVTL
FT                   TSQNITSQPVVNVRTDLADGDVGYFQFNSHNAIAEDQLYNAFNQFAASNIKDLVIDVRY
FT                   NGGGFLQMASQVAYMIAGRANTQGKVFERTVFNDKNPNTNPVTGQTLSPMPFTNQFVGF
FT                   ADNPATVPGSALPTLNLNRVFVLTTSSTCSASEAIINGLRGADIEVIQIGSGTCGKPYG
FT                   FYPTDNCATTYFTIQFSGINNKGFGEYADGFAPKNTIDNAFQPVLLNGCALADDFSQPL
FT                   GNANEALLKTALNYRNTGSCPAPSSINSKQGFAPAITTDSPEVKDTRIQTLLEQNTILS
FT                   DNMR"
     atgcactcta aaattcgtga caaaaaaaca acaacactcg cttccttagc actgcttagc        60
     gttttatctg ggtgtggcgg cggtagcgat agcgagggcc ttactcctaa tagcaatacc       120
     aatagctgga gcgcaggggt atttgccagt gccagccaat ttaaaggaca atgccaagca       180
     agtaatgaaa aaaactggct gcgttcgtgg agtaacgaaa cctacctttg gtacgatgag       240
     ataatagata ccgatccagc gcttacaagc ggcgtagttg cttattttaa caccttaaaa       300
     accaatgaac tgaccgattc aggcgctaaa aaagataact accactttaa cttacctacc       360
     gatgagtggc agcgccaaag tcaatcaggg gtaacctatg gctatggctt taatataaaa       420
     atacttgcta gcagcgcgcc acgccaagcc gttattagct ataccgagcc aaatacacct       480
     gcgagtaatc aaaaccttgc tcgtggcttt gaacttgttg cagtagatgg cattgatttt       540
     gtaaatacga cttccagcag tgaagttgct cttattagtg caagtttgtt tcctgagcaa       600
     acaggtaaaa cgaccgagtt tgtatttaaa gacataaata ctaaccaaaa ccgtaccgta       660
     acactcacct cgcaaaatat tacctcgcaa ccggtagtca atgtgcgtac cgacttagcc       720
     gatggcgatg tgggttattt tcagtttaat agccataatg cgattgctga agatcagctc       780
     tacaatgcat ttaaccaatt tgcagcaagt aacattaaag acttagtgat tgacgtacgc       840
     tataacggcg gcggcttttt acaaatggcc agccaagtag cctatatgat tgcgggccgc       900
     gcgaacaccc aaggaaaagt gtttgagcgt actgttttta acgataaaaa tccaaatacc       960
     aacccggtaa ctgggcaaac acttagccca atgccgttta ctaatcagtt tgtgggattt      1020
     gccgataacc ctgcaactgt gcccggtagc gcactgccaa cattaaacct aaaccgcgta      1080
     tttgttctca cgactagcag cacctgttca gcaagcgaag ccattattaa tggtctgcgc      1140
     ggcgctgaca ttgaagtgat ccagataggc tctggtacct gtggcaagcc ttatggcttt      1200
     tatcctaccg ataactgcgc aaccacctat tttaccattc agtttagcgg tataaataat      1260
     aaaggttttg gcgagtatgc tgatggcttt gcgccaaaaa acactattga taacgctttt      1320
     caacccgtat tattaaatgg ttgtgcgctt gccgatgact tttctcagcc attaggtaat      1380
     gccaatgaag cactgcttaa aacagcgctt aactatcgaa ataccggtag ctgccctgcg      1440
     ccaagctcca taaacagtaa acaaggtttt gcacctgcta ttacaactga ttcgcctgaa      1500
     gtaaaagata cgcgaattca aaccttgctt gagcaaaata ctattcttag cgataacatg      1560
     agataa                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page