(data stored in ACNUC7421 zone)

EMBL: CR954246.PE275

CR954246.PE275       Location/Qualifiers
FT   CDS_pept        complement(304425..305264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0290"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85389"
FT                   /db_xref="GOA:Q3IEX7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX7"
FT                   /protein_id="CAI85389.1"
FT                   /translation="MSRAIIDPHVHFFNLLEGQYTWLQGANPPPWPNLDKIKQPISAAQ
FT                   LMQDCDFKLAGLVHIEAGFDNSAPINELNWLTKHLAGITYKAVSFAQIDQSNQLFSHAL
FT                   SNLSHPSLAGIRDITQGDDAKRLLSSNCYNNFETLQQLKLHFEAQFELENHIIVKQIAQ
FT                   YAKQFPQLQIILNHAGLPHNMPAWQQGIKLLAKYHNIAIKFSGFELLKLNSGQQAQCFN
FT                   IILQHFGEQRIMFASNFPVCQINTQYNDLWQAHFNLCSNQALWQQLSYKNAKHCYQL"
     atgagtcgtg ctattattga cccccatgtg cattttttta atctacttga ggggcaatat        60
     acttggttac aaggcgctaa cccgccgcca tggcctaact tagacaaaat aaagcagccg       120
     atcagtgctg cgcaattaat gcaagattgc gactttaaac ttgcaggctt agtgcatatt       180
     gaagcggggt ttgataacag cgcacctata aacgagctta actggctcac caagcacttg       240
     gctggcatta cttacaaagc cgttagtttt gcccagattg atcaaagcaa tcagctattt       300
     agccatgcgc tcagtaacct ttcccatcca agcttagcgg gcattagaga tattacccaa       360
     ggtgatgacg ccaaacgttt gctcagcagt aattgctaca ataactttga aacgttacag       420
     cagttaaaat tacattttga agcccagttt gagcttgaaa accatattat agttaagcaa       480
     attgctcaat acgccaaaca gtttccacag ttacaaatta tacttaatca cgcaggttta       540
     ccccacaata tgccagcgtg gcagcaaggc attaaattac tcgccaagta ccataacatt       600
     gcaattaagt tttcgggatt tgagttactt aagctcaata gcgggcagca agcacagtgc       660
     tttaatatta ttttgcaaca ctttggcgag caaagaataa tgtttgcgag taacttcccc       720
     gtttgccaaa tcaataccca atataacgac ttatggcagg cacactttaa cttatgtagt       780
     aaccaagcac tttggcagca attaagctat aaaaacgcta aacactgcta tcaactctaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page