(data stored in ACNUC7421 zone)

EMBL: CR954246.PE276

CR954246.PE276       Location/Qualifiers
FT   CDS_pept        complement(305261..305989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0291"
FT                   /product="putative glucose/ribitol dehydrogenase family"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85390"
FT                   /db_xref="GOA:Q3IEW4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW4"
FT                   /protein_id="CAI85390.1"
FT                   /translation="MSKVAIVTGGTKGIGLAVVQRLLASGYEVHNLDITPSNFGEFHHC
FT                   DVSDVTVVRHCINAIVEQTQRIDVLVSNAGKHLSANIESTDEQTLDALFALNVKGAYAA
FT                   VQSVLPIMKTQNNGAIVLIASDQAIIGKKNSFAYNLTKHALASMAKTTALDYASFNIRA
FT                   NAVCPGTIETPLFHNAIDAYCKNSGANKAQTVAEEAALQPLNRLGQADEVAALVNFLVS
FT                   DDASFITGSLQSIDGGYTAQ"
     atgtcaaaag tggctattgt taccggcggc accaaaggta ttggtttagc ggtagtacag        60
     cgcttactag caagcggcta tgaagtacat aaccttgata taacaccaag taactttggt       120
     gagtttcatc attgtgatgt aagcgatgtc actgttgtac gtcattgtat taatgccata       180
     gttgagcaaa cgcagcgcat tgatgtactt gtttctaatg caggaaaaca tttaagcgcc       240
     aacatagaaa gtaccgatga gcaaactctc gatgcactat ttgcgcttaa tgtaaaaggc       300
     gcgtatgcgg cagtgcaaag tgtattacca ataatgaaaa cccaaaacaa cggcgctatt       360
     gtgcttatag cctcagatca ggcaattata ggtaaaaaaa attcatttgc ttataacctg       420
     actaaacacg cccttgcttc tatggcaaaa accaccgcgc ttgattacgc gagttttaat       480
     attagggcta atgccgtgtg ccctggcact atagaaacac cgttatttca taacgccata       540
     gacgcttact gtaaaaacag tggtgccaat aaagcacaaa cagtagccga agaggcggca       600
     ttgcagccac ttaaccgttt aggccaagct gatgaagtag ccgctttagt gaatttttta       660
     gtcagcgatg atgcaagctt tatcaccggt agcttgcaaa gtattgacgg tggttataca       720
     gcgcaatga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page