(data stored in ACNUC7421 zone)

EMBL: CR954246.PE279

CR954246.PE279       Location/Qualifiers
FT   CDS_pept        complement(308112..309128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0294"
FT                   /product="putative orphan protein ; putative
FT                   beta-lactamase-like domain ; putative signal peptide"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85393"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX4"
FT                   /protein_id="CAI85393.1"
FT                   /translation="MKSALRLFKLSKYLLLLNSFYFAANANADVTWEKISPNIQFLKQQ
FT                   HKLRFYDSNQVLIEGSKCALLVDTSGNFAAVEQLASDLKKHLTTPLCYLVATHFHDDHL
FT                   LGMAVMQHFYPDAQLITHQQVKTDFALYQQAFNDKLEGFEKSIELSYQRLATLPENEQA
FT                   QWRTKLERAKQRLFRWQKYQLNAPEISINTNKTLDLGNFEITLNAHQAHTNGDLTITTN
FT                   SGSTLIGGDIVDWLPYPGHGELSSWRALLQQYINDSVLKTIIPGHGELTNKSQLQQSHA
FT                   FLTAITEHVANNSGQTIEQLMLSFPDVAIKPYMQESLNAKSSNLFLQAGLIRAINAK"
     atgaagtcag ccctgcgttt atttaaatta agtaagtacc tactactgct taactctttt        60
     tattttgcag ccaatgctaa cgccgatgtt acgtgggaga aaataagtcc caatattcaa       120
     tttttaaaac aacagcataa actacgtttt tacgactcaa accaagtatt aattgaaggt       180
     agtaaatgcg cactgttagt agataccagc ggcaactttg ctgcagtaga acaacttgct       240
     agcgatttaa aaaagcactt aacaacacct ttgtgttact tagtggccac tcattttcat       300
     gacgatcatt tgctggggat ggctgtaatg cagcactttt accccgatgc gcaattaatt       360
     acccatcagc aagtaaaaac tgactttgcc ctttatcagc aagcatttaa cgataagcta       420
     gaaggattcg aaaaaagcat tgagcttagc taccaacgct tagcaacact ccccgaaaat       480
     gagcaagcgc agtggcgtac aaagttagaa cgcgctaaac agcgcctatt ccgctggcaa       540
     aaatatcaac tcaatgcacc tgaaataagc ataaacacca ataaaacatt agacttaggc       600
     aattttgaaa ttactttaaa cgcccaccaa gcacatacca atggcgattt aaccattaca       660
     actaacagtg gcagcacttt gattggtgga gatattgttg actggcttcc ctaccctggc       720
     cacggcgagc taagcagctg gcgcgcactg ctacaacaat atattaatga ctcagtgcta       780
     aaaactataa ttcctggtca tggtgaacta actaataagt cgcaactgca gcagtcgcac       840
     gcatttttaa ccgccattac agagcatgta gctaataata gtgggcaaac aatagagcag       900
     ttaatgctgt catttcctga tgtcgcgatt aaaccctaca tgcaagagtc gcttaatgcc       960
     aagtcgagta atttattttt acaagcagga ttaattcgcg cgataaacgc aaaataa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page