(data stored in ACNUC7421 zone)

EMBL: CR954246.PE28

CR954246.PE28        Location/Qualifiers
FT   CDS_pept        30853..31416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0028"
FT                   /product="putative double-stranded RNA-binding protein with
FT                   unique protein fold, with YrdC/RibB domain"
FT                   /function="3.2.1.1.2 : Regulatory proteins (RNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85142"
FT                   /db_xref="GOA:Q3IDH7"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDH7"
FT                   /protein_id="CAI85142.1"
FT                   /translation="MSDQSTIAAAITCLAQGEVILYPTEAVYGLGCDPDNQQAVERLLA
FT                   IKQRPVEKGLILIADNYGQLLKYVDDAKIPMDKRADIFSSWPNAITWVMPAAKNTPKWL
FT                   TGQYDTIAVRVTNHPTVKRLCQEFGKPLVSTSANLSGQNTVLSIAEAKSQFTEQIGYYV
FT                   DEPLGGNTQPSTIKDAMNGKVFRG"
     ttgtcagatc aatctactat agctgctgct ataacatgtt tagcgcaagg cgaagtgatt        60
     ttatacccta cagaagctgt atatggctta ggttgcgatc cagataatca acaagcagtt       120
     gagcgactac tggctattaa acagcgcccg gtcgaaaaag gccttatttt aattgccgat       180
     aactacgggc agttattaaa atatgtagat gatgccaaaa tcccaatgga taaacgcgct       240
     gacatttttt caagttggcc aaatgcgatt acttgggtta tgcccgcagc taaaaacacc       300
     ccaaagtggt taactgggca gtatgacact attgcagtta gggtgactaa ccatccaacc       360
     gtaaagcgct tatgccaaga gtttggtaag ccactggtat caactagcgc taatttaagc       420
     ggtcaaaata cagtattaag cattgccgag gctaaaagcc agtttactga gcagataggt       480
     tattatgttg atgagccact cggtggtaat acgcaaccaa gtacaattaa agatgccatg       540
     aatggcaaag tatttagagg ttaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page