(data stored in ACNUC7421 zone)

EMBL: CR954246.PE280

CR954246.PE280       Location/Qualifiers
FT   CDS_pept        complement(309188..309493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0295"
FT                   /product="conserved protein of unknown function; putative
FT                   FtsZ-associated protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="1.7 : Cell division"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85394"
FT                   /db_xref="GOA:Q3IEX3"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX3"
FT                   /protein_id="CAI85394.1"
FT                   /translation="MSELQNQRVTVELLGKEQQFACPPGQEEALKAAAKNLNDLVEQMK
FT                   QRSTVKNEQNALLMAALNLSHELLEAKTIKAVDLQHQDQLIDKLSQHLSNDSKHNK"
     atgtctgagc tgcaaaacca gcgagtcact gttgaattgc ttggtaaaga gcagcaattt        60
     gcttgcccac ctgggcaaga agaggcactt aaagcggcag ctaaaaatct caatgatttg       120
     gttgagcaaa tgaaacaacg ctctactgtt aaaaatgagc aaaatgccct acttatggca       180
     gccttaaatt taagccacga attgctagaa gcaaagacta taaaagccgt tgatctgcaa       240
     caccaagatc aactcattga taagttgagt cagcacttat caaatgactc taaacataat       300
     aaataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page