(data stored in ACNUC7421 zone)

EMBL: CR954246.PE283

CR954246.PE283       Location/Qualifiers
FT   CDS_pept        309962..310801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0298"
FT                   /product="conserved protein of unknown function ; putative"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85397"
FT                   /db_xref="GOA:Q3IEX0"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX0"
FT                   /protein_id="CAI85397.1"
FT                   /translation="MLSYRHSFHAGNPADVLKHLVLAQVLGYQTLKDKPLDYIDTHSGA
FT                   GFFELAAADAQKTQEYQDGIEKLWQHTSKHSALNDYIALIKSFNQTANLEFYPGSPKIA
FT                   EHFLRRQDKGWFFELHPRDLLLLEENMQGKRSIRVRGENGFAGLVGLLPPASRRACVLI
FT                   DPPYEVKDDYDTVITTLMQAYQRFATGTYMIWYPVVDRSRIDNMEQDLIDSGMRNIQLF
FT                   ELATKADTDVHGMTASGMIVINPPWKLKQVMDEVLPELVSILSESSGFYRSEQLVAE"
     atgcttagtt acagacactc atttcatgcc ggaaaccctg ccgatgtact taaacattta        60
     gtgttagcac aagtgttagg ttaccaaact ttaaaagata agccactgga ttatatagac       120
     actcattcgg gtgcgggctt tttcgaatta gcagcggccg atgcacaaaa aacacaagag       180
     tatcaagacg gcattgaaaa actgtggcaa cacactagta aacactcagc tttaaacgac       240
     tatattgcac tgatcaaatc gtttaaccaa acagccaatt tagagtttta tccgggttcg       300
     ccaaaaattg cggaacactt tttacgccgc caagataaag gctggttttt tgagctgcac       360
     ccacgtgatt tgttattact agaggagaac atgcaaggga agcgttcgat tcgagtacgt       420
     ggcgaaaatg gttttgctgg tttggttggc ttattacccc ctgcatcgcg tagagcctgc       480
     gtgttaatag acccacctta tgaagtcaaa gacgattacg acactgttat tactacgttg       540
     atgcaagcgt accagcgctt tgctaccggc acatacatga tttggtatcc tgttgttgac       600
     cgcagccgca ttgacaacat ggagcaagac ctaattgact ctggcatgcg taatattcaa       660
     ttatttgagc tagctaccaa agccgatacc gacgtgcatg gcatgactgc ctcggggatg       720
     atagtaatta atccaccgtg gaaattaaaa caggttatgg atgaggtgtt gccagagctg       780
     gtgagtatat tgagtgaatc aagtggtttt tatcgcagcg agcagttagt cgcagagtaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page