(data stored in ACNUC7421 zone)

EMBL: CR954246.PE284

CR954246.PE284       Location/Qualifiers
FT   CDS_pept        complement(310858..311667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0299"
FT                   /product="conserved protein of unknown function ; putative
FT                   lipoprotein precursor"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85398"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW9"
FT                   /protein_id="CAI85398.1"
FT                   /translation="MFKRKPSSILKSVAGISFLASGALVLSGCDDAKNTAQATQAESTA
FT                   TLTTEVSYLDRSMLAPNSQLTVTLADVSKMDIKATVISQQVIDLNGGPPYTVELAYDTN
FT                   KINKALSYSVSARIENNGELLYTSTSNNNPFAADAQTSPYKIVVTKVDQKPDVDLANTY
FT                   WKAITLAGDNVTVTTKEPFIQFSNDGKVHGFLGCNNFNGGYEVNEQTVTFDHIAATQKM
FT                   CHENMDQEAAMSSMLSKAAQWQVNGESLSLKDEKGEQLATFKAVYFN"
     atgtttaaac gtaagccaag ttcaatttta aaatcggtag cagggatcag cttcttagcc        60
     agtggcgcat tggtattatc tggatgtgat gatgctaaga acactgcaca ggcaacacag       120
     gcagagtcaa cagcaacgct aacaactgaa gttagttacc ttgatcgcag catgttggcg       180
     cctaattcac agctaacagt aacacttgcc gatgtatcta aaatggatat taaagcaacc       240
     gttattagcc agcaggttat tgatttaaat ggtggtcctc cttatacagt agagcttgcc       300
     tacgacacta acaaaattaa taaagcactt agctacagcg ttagtgcacg tattgaaaat       360
     aatggtgagc tactctacac cagcacaagc aataacaacc cattcgcagc agatgcacaa       420
     accagcccgt acaaaattgt ggttacaaaa gtagatcaaa aaccagatgt tgatttagca       480
     aatacatatt ggaaagcaat cactttagct ggcgataatg ttacggttac aacaaaagaa       540
     cctttcattc aatttagtaa tgatggcaaa gtgcatgggt ttttaggctg caataacttt       600
     aacggtggtt atgaagttaa tgagcaaacg gtgacttttg atcacatagc ggcaacgcaa       660
     aaaatgtgtc atgaaaacat ggatcaagaa gctgcaatgt ctagcatgct aagtaaagct       720
     gcgcagtggc aagttaatgg cgaatcgttg agcttaaaag atgaaaaagg tgagcaacta       780
     gctaccttta aagccgttta ctttaactaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page