(data stored in ACNUC7421 zone)

EMBL: CR954246.PE285

CR954246.PE285       Location/Qualifiers
FT   CDS_pept        complement(311815..312381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0300"
FT                   /product="conserved protein of unknown function ; putative
FT                   PhnA protein(yjdM)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 2155230; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85399"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="InterPro:IPR013991"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW8"
FT                   /protein_id="CAI85399.1"
FT                   /translation="MSIEQALVERSNNQCELCAATDTLSVYEVPPVKEAHSDKCIYTCQ
FT                   VCKDQIEDTAELTPTHWHCLNDSMWSQTPAVQVVAYRMLSRLAADNGWAQDALDMIYLE
FT                   EDTLAWAQQVLAEDDDLKHLDSNGVVLKAGDTVTLIKDLDVKGSSLTAKRGTAVRNIGL
FT                   TSNPEHIEGRVDGQRIVILTKFVKK"
     atgagcattg aacaagcctt agtagaacgt agtaataacc aatgtgaatt atgtgcagca        60
     acagatactt tatctgtgta cgaagttccg ccagttaaag aagcccactc agataaatgt       120
     atttacactt gccaagtatg taaagatcaa attgaagaca ccgctgagtt aacccctacc       180
     cattggcatt gtttaaacga cagcatgtgg agccaaactc ctgcagttca ggtagttgct       240
     tatcgtatgt tgagccgctt agctgccgac aatggctggg cacaagacgc cctagatatg       300
     atttatttag aagaagatac attagcatgg gctcaacaag tacttgctga agatgacgac       360
     ctaaagcatc ttgatagcaa tggcgtagta cttaaagccg gtgataccgt aacgctaatt       420
     aaagatttag atgtaaaagg cagcagccta accgctaagc gcggtactgc ggtacgtaat       480
     attggcttaa ccagcaatcc tgaacatata gaagggcgtg ttgatggtca acgtattgta       540
     attctgacca agtttgttaa aaagtaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page