(data stored in ACNUC7421 zone)

EMBL: CR954246.PE286

CR954246.PE286       Location/Qualifiers
FT   CDS_pept        312623..313231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0301"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85400"
FT                   /db_xref="GOA:Q3IEW7"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW7"
FT                   /protein_id="CAI85400.1"
FT                   /translation="MRLLLPIVSILIALVLLVPGVTQPVLSLEGKIDKSKLAQTGIEMI
FT                   ADEGDRNTRNMLMMASSMFGLDKLEGEISAYQKTRSIWGTVNELAHNKNYLVAVLVAFF
FT                   SIVIPTIKLLMQLVFCLLPASKFKQNLGVTICALSKWSMVDVFVIALIVTYLAGNAEGE
FT                   TGGLIKMHAELGNGFWYFTGYCLFAIAASSFIKTDAKNI"
     atgcgcttac ttctccctat agttagtatt ttaattgctt tagttttatt ggttcccggt        60
     gttacccagc ctgtattatc cctagagggg aaaatagata agtctaaatt agcgcaaaca       120
     ggcattgaga tgattgccga tgaaggcgac cgcaacactc gaaacatgct gatgatggca       180
     tcaagcatgt ttgggttaga taagcttgaa ggtgagataa gtgcttatca aaaaacacgc       240
     agcatttggg gaacggttaa cgaactggct cataataaaa attatttagt ggcggtgttg       300
     gtggcttttt tctcaattgt aataccgact attaagttac taatgcaatt agtcttttgc       360
     ttattgccag cgagtaagtt taagcaaaat ctgggagtaa ctatttgcgc tttgagtaag       420
     tggagtatgg tagatgtgtt tgttattgca cttattgtta cttaccttgc aggcaatgcc       480
     gagggtgaaa ccggtgggct aattaaaatg cacgccgaac tggggaatgg cttttggtat       540
     tttaccggtt attgcttatt tgccattgcc gcgagtagtt ttattaaaac cgatgcaaaa       600
     aatatataa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page