(data stored in ACNUC7421 zone)

EMBL: CR954246.PE287

CR954246.PE287       Location/Qualifiers
FT   CDS_pept        313369..313740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0302"
FT                   /product="conserved protein of unknown function ; putative
FT                   signal peptide"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW6"
FT                   /protein_id="CAI85401.1"
FT                   /translation="MQRIYSSLLIIAMLLTLVGQAVASVAMLCEMPHMSQTQHAATNVA
FT                   TEKVHQQMSVSMMNMDCCDDAATEQECNCPINACSAYSMLSVDGLFSTPLIISEKIQLY
FT                   PSQNQHHLVSSLYRPPMSA"
     ttgcaacgca tttactctag tttactgatc atcgctatgt tactcacgct tgtgggtcag        60
     gctgttgcgt ctgttgctat gctatgtgaa atgccgcaca tgagccaaac acagcatgct       120
     gcaactaatg ttgcaactga aaaagtacat cagcaaatgt cagtcagtat gatgaatatg       180
     gactgttgcg atgatgcagc aaccgagcaa gaatgtaatt gcccaattaa tgcttgttca       240
     gcgtactcaa tgttgagtgt tgatggttta tttagcaccc cactgattat ttctgaaaaa       300
     atacagctct atccctcaca aaaccaacac catttagtca gctcgctata ccgcccccct       360
     atgtctgctt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page