(data stored in ACNUC7421 zone)

EMBL: CR954246.PE288

CR954246.PE288       Location/Qualifiers
FT   CDS_pept        313832..315157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0303"
FT                   /product="putative outer membrane cation efflux protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85402"
FT                   /db_xref="GOA:Q3IEW5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW5"
FT                   /protein_id="CAI85402.1"
FT                   /translation="MNHFAVFKVSFLALMLGTAISAHSNELSLDEALSYALNHEPWLKA
FT                   SQYQQASEQAQSIAAGSLPDPVLTLGLMGVPTDGFALDQEGMTQLSIGVSQMFSRGDSL
FT                   ALKQQALAQSAQQHPWLRADRLAQVKTIVIESWLNAYRAQRSIALIEQDKALFSQLIDI
FT                   TESSYASSLGKTRQQDIIRAQLELTRLEDKLVMLAQQLESAKKRLSQWLPMSMLTQPVS
FT                   TKNTAIEPLISFTTLEFEALMSLLMAHPAIVAIDQTVTAKQTEIALAKQSYKPQFGVNM
FT                   GYSHRGDTPMGDSRADLLSVGVSIDLPLFTSNRQDQQVNAAIATAEAVKTQKLIALQKL
FT                   KGMYFKEFSQLMQLQKRDTLYQTKLLPQMAEQAQATLNAYTRDDGDFSEVMRARISELN
FT                   AKIDGLNIQIDQQIIIARLNYYASSQDAAVMLEQLGEQNREY"
     atgaatcact ttgcagtatt taaagtcagt tttttagcgc taatgctagg aactgcaatc        60
     tcagcacaca gcaatgaact tagcctagat gaggcgcttt cgtatgcgct aaaccatgag       120
     ccttggctaa aggcaagcca gtaccaacaa gcctcagagc aagcacaaag tatagccgca       180
     ggtagtttgc ctgatccggt attaactttg ggtttaatgg gcgtgccaac cgatggtttt       240
     gctttagatc aagaaggtat gacgcagcta agtattggtg taagccaaat gtttagtcgt       300
     ggcgacagcc tagcattaaa acagcaagcc ttagcacaat ctgcgcagca acatccttgg       360
     ttgcgagccg atcgccttgc acaagtaaaa acaattgtta ttgaatcatg gcttaatgcg       420
     tacagagctc agcgcagcat tgcgcttatc gaacaagata aagccttatt ttcgcaactg       480
     attgatataa ccgaatcaag ttatgccagc tcgctaggca aaactcgtca gcaagatatt       540
     attcgcgctc agttagagct cactcgccta gaagataaat tagtaatgct agcgcagcaa       600
     cttgaaagtg ctaaaaaacg gctgtcgcaa tggttgccaa tgagcatgct aactcaacca       660
     gtaagtacta aaaacacagc tattgagccg ttaattagtt ttaccacgct ggaatttgag       720
     gcgctaatgt cgttacttat ggcgcatccc gcgattgttg ctattgatca aacagtaaca       780
     gctaagcaaa cagaaatagc gctcgcaaag caaagttata agccgcagtt tggagtaaat       840
     atgggctata gccatcgagg tgatacgcct atgggagact cacgagccga tttactctct       900
     gttggggtaa gtattgattt gccgttattt actagtaacc gccaagatca gcaagttaac       960
     gctgcaatag cgacagctga agcagttaaa actcaaaagt taatagcgct acaaaagtta      1020
     aaagggatgt atttcaaaga gtttagccaa ttaatgcagc tacaaaaacg cgatacgctt      1080
     tatcaaacta agttattacc gcaaatggca gagcaagccc aagccacact caatgcatac      1140
     acgcgggacg acggtgattt ttcagaagtt atgcgtgctc gtattagtga gcttaatgcc      1200
     aaaattgacg gcttaaatat tcaaatagac caacaaatta ttattgctcg tctaaattat      1260
     tatgccagta gccaagacgc tgctgtgatg cttgagcaat taggagagca aaatcgtgaa      1320
     tactaa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page