(data stored in ACNUC7421 zone)

EMBL: CR954246.PE289

CR954246.PE289       Location/Qualifiers
FT   CDS_pept        315147..316895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0304"
FT                   /product="putative cation efflux system protein"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12813074; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85403"
FT                   /db_xref="GOA:Q3ILD2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD2"
FT                   /protein_id="CAI85403.1"
FT                   /translation="MNTNLKLLIAAVVGGGVTALVLSLMPASNTDIKASTEKQPLYWVA
FT                   PMDSNYRRDEPGLSPMGMDLVPFYDEAPGSSSNLDGPGAVTISPAVVNNLGVRIAKVQH
FT                   KALQNEVKTVGYVQYNQDQLIHIHPRVEGWLETLYIKAAGDSVEHGEPLYTLYSPQLVN
FT                   AQEEFLLALNRNNQVLIRAAKARLKSLNISDDFVERLQKSKQVMQNITFYAIQSGVVEE
FT                   LNVREGFYVNPGTTMMSIGKLDEVWVEAQVFERQAELIKIGQPVSMTLDYLSGQSWQGK
FT                   VDYIYPTLDAKNRTLRVRLRFNNEGHKLKPNMFAQVNIHTQANKAQLVVPKEAVIRTGN
FT                   QNRVVVALGEGRFKSVAVEMGRSDSKNTAILSGIMADDDVVVSAQFLLDSESSKSSDFK
FT                   RMQAPQAVSSVWSEGIVNSIMAEHRMVNISHEPIAELDWPSMTMDFTVADDVDFTAFEN
FT                   GQTLHFELTKQADGSYVLTAIHIMKSTVTNSEKNTATVLGTINSIDKAQRIANISRGAI
FT                   EKWGREPARLDFTFADDIDLTALAAQQQINFTFSLQQGEFVISHINGEHSTSASGNHTM
FT                   QLHNAH"
     gtgaatacta atttaaaact attaatagca gctgtagtgg gtggtggagt aacggcatta        60
     gtattatcgc ttatgcccgc gagcaatact gatattaaag caagcacaga aaaacaacca       120
     ctgtactggg tagcacccat ggatagtaat tatcgacgtg atgaacccgg gctttcgcca       180
     atgggcatgg acttagtgcc tttttatgat gaagcaccag gcagtagtag taatttagat       240
     ggcccaggtg ctgtgactat ttcgccagcg gtagttaata atctcggggt aagaatcgct       300
     aaagtgcagc acaaagcgtt acaaaatgaa gttaaaacgg ttggctatgt gcaatataat       360
     caagatcaac ttattcatat tcacccccgt gtagagggct ggttagaaac gctttatatc       420
     aaagcagcag gcgacagtgt tgagcacggt gagccacttt ataccttgta ctcaccgcaa       480
     ttagtgaatg cccaagaaga gtttctatta gcgctcaatc gtaacaacca ggtgctaatt       540
     cgcgcagcta aagcacgctt aaagtcactt aatatatcgg atgattttgt agagcggctg       600
     caaaaaagta agcaagtaat gcaaaacatt accttttatg ccattcaaag tggcgtagtt       660
     gaagagctaa atgtgcgcga aggtttttat gttaaccccg gcaccactat gatgagtatt       720
     ggtaagcttg atgaggtatg ggttgaagcg caagtgtttg agcgccaagc tgagctaatt       780
     aagattggcc agccagtaag catgacgctt gattatttaa gtggccaaag ctggcagggt       840
     aaagtggatt atatttaccc aacactcgat gctaaaaacc ggaccttgcg agtgcgcctg       900
     cgctttaata acgaaggcca taaacttaag cctaatatgt ttgcccaagt aaatattcat       960
     actcaagcca ataaagcgca attagtagtc cctaaagaag cggtgatccg caccggtaac      1020
     caaaaccgtg tagtggttgc cttgggcgag gggcgtttta aatctgtggc tgtagaaatg      1080
     ggcagaagtg acagtaaaaa caccgcaata ttatcaggaa taatggcaga tgatgacgtg      1140
     gtggtttcgg cgcaattttt attagattca gaatcaagta aaagctcaga ctttaaacgt      1200
     atgcaagccc ctcaagctgt tagctctgta tggagcgagg gcattgttaa tagcattatg      1260
     gcggaacatc gtatggttaa tattagccat gagccgatag ctgaacttga ttggcctagt      1320
     atgacaatgg actttacggt tgctgatgat gttgacttta ctgcttttga aaatggccaa      1380
     acattacatt ttgagctgac taagcaagct gatggcagtt atgtattaac ggctattcat      1440
     ataatgaaaa gcacagtaac aaatagcgaa aaaaatacag caactgtttt gggcacaatt      1500
     aacagtattg ataaagcaca gcgcatagca aatattagcc gtggtgcaat agaaaaatgg      1560
     ggacgcgaac ctgcaaggct cgattttacc tttgcagatg atatagattt aaccgcactt      1620
     gcagcgcagc aacaaataaa ctttaccttt agtttgcagc aaggggagtt tgtgattagc      1680
     cacataaatg gcgagcactc tacaagcgca tcaggtaatc acactatgca attgcataac      1740
     gcgcattag                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page