(data stored in ACNUC7421 zone)

EMBL: CR954246.PE291

CR954246.PE291       Location/Qualifiers
FT   CDS_pept        320162..320617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0306"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85405"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD0"
FT                   /protein_id="CAI85405.1"
FT                   /translation="MQVKTIQQMYDWTILFHTQMAANFFSVRELLGEHNTQLVDYCTKY
FT                   EKKLAEDLIGFKAITTINTLDTYCYEYFAENPELLNFTDLDRSTQLDEQAIQGYLSDQH
FT                   QKVINAYEYLEGKTQTADGKEKLGQILQLEYQGLKQMVQSINRHIDM"
     atgcaagtta aaacaattca acaaatgtat gactggacta ttttgtttca tacacaaatg        60
     gcggccaact tttttagtgt gcgggaacta ttaggtgagc ataatactca attagttgat       120
     tactgtacta aatacgaaaa aaaactcgct gaagatttaa ttggctttaa agcaatcacc       180
     accataaata cgttagatac ctactgctat gagtattttg cagaaaatcc agagctactg       240
     aattttactg atttagatcg aagtacccaa ttagatgagc aagctattca gggctatttg       300
     tctgatcagc atcaaaaagt aataaatgct tatgagtact tagagggaaa aacacaaact       360
     gcagacggta aagaaaaact cggacaaata ctgcagcttg agtaccaagg attaaaacaa       420
     atggtacaaa gcataaaccg acatatagat atgtaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page