(data stored in ACNUC7421 zone)

EMBL: CR954246.PE292

CR954246.PE292       Location/Qualifiers
FT   CDS_pept        320768..320887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0307"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85406"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC9"
FT                   /protein_id="CAI85406.1"
FT                   /translation="MIQYVSKSLNQSSGYVNLYTVKTNKNNGATLWCVAPLFC"
     atgattcaat acgttagtaa atctcttaac cagagttcag gttatgtaaa tttatataca        60
     gttaaaacta ataaaaataa cggcgctaca ttatggtgtg tagcgccgtt attttgttaa       120
//

If you have problems or comments...

PBIL Back to PBIL home page