(data stored in ACNUC7421 zone)

EMBL: CR954246.PE293

CR954246.PE293       Location/Qualifiers
FT   CDS_pept        complement(320884..321390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0308"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85407"
FT                   /db_xref="GOA:Q3ILC8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC8"
FT                   /protein_id="CAI85407.1"
FT                   /translation="MKQLVITILGQDRPGLVESISSVILENHGNWLSSNLSHLLGHFAG
FT                   IIQIEVSEEHFQALQNALNALPKLDVRIETGNTEIEPATREQLNFVITGNDRPGIVQEL
FT                   ASVIRHKGANITHLNSRQQSAPNWGVPIFSAVATVTLPNGLNKEEVINALESITSDLIV
FT                   DVEKV"
     atgaagcagt tggttataac cattttagga caagatcgtc ctggtttagt agagagcatt        60
     tcatccgtta ttttagaaaa tcatggcaac tggctaagca gcaacttgag ccatttgctc       120
     ggtcactttg caggtattat tcagattgaa gttagcgaag agcattttca ggcactgcaa       180
     aatgcgctca atgctctgcc taaacttgat gtacgtattg aaacaggcaa tacagaaata       240
     gaacccgcca cacgtgagca acttaacttt gttattaccg gtaacgatcg cccgggtatt       300
     gtgcaagagc ttgcaagtgt aattcgtcat aaaggagcca atattactca cttaaactca       360
     aggcaacaaa gcgcacctaa ttggggcgtg cctattttta gtgctgttgc tacagtaaca       420
     ctacctaatg ggttgaataa agaagaagta attaatgcat tagagtcgat aacaagcgac       480
     ttaattgttg atgtagaaaa ggtttaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page