(data stored in ACNUC7421 zone)

EMBL: CR954246.PE298

CR954246.PE298       Location/Qualifiers
FT   CDS_pept        327389..328066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0313"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85412"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC3"
FT                   /protein_id="CAI85412.1"
FT                   /translation="MQTNAFLGVFAKSPIKPMEEHIRKVHQASKALIPFFNHVFKEEWQ
FT                   QAEELRLTIRNLEREADEMKRNIRLQLPRGLFMPVERTDLLELVTQQDKIANKAKDIAG
FT                   RVIGREMIIPKVIQIDFLAYLTRCVDATKQASNAINELEELLETGFKGREVALVEKMLV
FT                   ELDAIEQDTDEMQIKIRRQLRAVEGELNPVDVMFLYKIIEWVGELADIAERVGSRLELM
FT                   LAR"
     atgcaaacta acgcgtttct aggagtattt gcaaaatctc ctatcaaacc aatggaagaa        60
     catattcgaa aggttcatca agctagtaaa gctttgattc ctttttttaa tcacgtattt       120
     aaagaagaat ggcaacaagc tgaagagcta cgtttaacca ttcgtaattt agaacgtgaa       180
     gccgatgaaa tgaaaagaaa tatacgttta caactaccgc gtggattatt tatgccggta       240
     gagcgtacag atctgctcga attagtaacc cagcaagata aaattgccaa taaagcaaaa       300
     gacattgcag ggcgtgtaat tggtcgtgag atgatcatac caaaagtaat tcaaatcgac       360
     tttttagctt atttaacacg ttgtgttgat gctactaaac aagcatctaa tgcgataaat       420
     gagttagaag agctattaga aacaggtttt aaaggtcgcg aagtggcctt ggttgaaaaa       480
     atgctcgttg aattggatgc catagaacaa gacacggatg aaatgcaaat taaaatacgc       540
     cgccaactac gcgcagtaga aggtgagtta aacccggttg atgtgatgtt tttatataag       600
     atcattgaat gggttggcga gcttgcagat attgcagagc gcgtaggatc acgtcttgag       660
     ctgatgttag ctcgttaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page