(data stored in ACNUC7421 zone)

EMBL: CR954246.PE299

CR954246.PE299       Location/Qualifiers
FT   CDS_pept        328169..329374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0314"
FT                   /product="putative inorganic phosphate transporter"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85413"
FT                   /db_xref="GOA:Q3ILC2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC2"
FT                   /protein_id="CAI85413.1"
FT                   /translation="MAYGIGANDVANAMGTSVGSKALTIKQAIFIAMIFEFAGAYLAGG
FT                   EVTSTIRNGIIDSTPFMDIPELMILGMISALFAAGAWLLMASFLGWPVSTTHSIIGAII
FT                   GFALVAVGSEAIHWNKVAGIVGSWIVTPAISGFIAYLIFMSAQKLIFDTATPLKNAKRF
FT                   VPIYMGLAGFIMSLVTIKKGLKHIGINLGTVEGISLSIAIAVVVGFIGKIAISRLKIDP
FT                   QADKKMQFNNVEKVFAVLMVLTACCMAFAHGSNDVANAIGPLAAVVSIVENNGEIAKQA
FT                   AIAWWILPLGGFGIVAGLAILGKKVIKTIGEGITHLTPSRGFAAELAAASTVVIASGTG
FT                   LPISTTQTLVGAVLGVGMARGIAALNMGVIRNIVVSWVITLPVGAGLAIVIFYVLRTAF
FT                   GV"
     atggcttatg gtattggcgc aaatgatgtt gccaatgcaa tgggcacatc agtaggctct        60
     aaagcgctaa cgattaaaca agcgattttt atcgcgatga tctttgagtt tgcaggtgct       120
     tacttggccg gcggcgaagt tacatcgaca attcgtaatg gcattattga ttcaacgcca       180
     tttatggata ttcctgaatt aatgatatta ggtatgattt ctgcgctttt tgcagcaggc       240
     gcctggctat taatggcatc attcttagga tggccagtat caactactca ctctattatt       300
     ggcgctatta taggttttgc tttagttgca gtaggcagtg aagcgattca ttggaacaag       360
     gttgcaggaa ttgttggtag ttggatagta acgcctgcta tatcgggttt tattgcctac       420
     ttaatattta tgagcgcaca aaagcttatt tttgatacgg ctactccgct taaaaatgct       480
     aaacgtttcg tgccaattta tatgggctta gctggcttta ttatgtcact tgtgacaatt       540
     aaaaaaggct taaaacatat tggtattaac ttaggcacag tggaaggtat tagtctatct       600
     attgcgattg cagtagtagt aggctttatt ggtaaaattg caatttcacg tttaaaaatc       660
     gaccctcagg ccgataaaaa aatgcaattt aataacgttg aaaaagtttt tgcagtactt       720
     atggtcttaa cggcttgttg tatggcattt gctcatggtt ctaacgacgt tgctaatgct       780
     attggtcctc ttgcggctgt ggtaagtatt gttgaaaaca acggtgaaat tgcaaaacaa       840
     gcggctattg cttggtggat attaccacta ggtggttttg gtattgtggc cggtttagct       900
     attttaggta aaaaagtaat taaaacgatt ggcgaaggga tcacacattt aacccctagc       960
     cgtggttttg ctgctgaatt agctgctgct tcaactgttg taattgcatc tggcacaggc      1020
     ttaccaattt caactacgca aaccttagtg ggtgcggtgt tgggtgtagg tatggcacgc      1080
     ggtattgccg cactgaacat gggtgttatt agaaacattg tagtttcttg ggtaattaca      1140
     ttgccagtgg gcgcaggcct tgctattgtt attttctacg tactaagaac cgcatttggg      1200
     gtttaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page