(data stored in ACNUC7421 zone)

EMBL: CR954246.PE30

CR954246.PE30        Location/Qualifiers
FT   CDS_pept        complement(32430..32867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0030"
FT                   /product="putative hemoglobin-like oxygen-binding protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11900532, 11796724; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85144"
FT                   /db_xref="GOA:Q3IDI7"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="PDB:4UUR"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI7"
FT                   /protein_id="CAI85144.1"
FT                   /translation="MIKRLFSKSKPATIEQTPTPEKTPYEILGGEAGALAIANRFYDIM
FT                   ATDEYAKPLYDMHPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQD
FT                   LRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH"
     atgattaaac gacttttttc aaaatctaag cccgccacaa tagagcaaac acccacacct        60
     gaaaaaacac cttatgaaat actaggtgga gaagcaggcg cacttgctat tgcaaataga       120
     ttctacgata ttatggctac agatgaatac gctaaaccat tatatgatat gcatcctctg       180
     ccattagata gaattcgcca agtgtttttt gaatttttat ctggctggtt aggcggccca       240
     gacctatttg tagcaaaaca tggccatcct atgctgcgta aacgccatat gccttttacc       300
     attgatcaag acttgcgcga ccaatggatg tactgcatga ataaaacatt agaccttgaa       360
     gtagataatc cattactacg agaaggcctt aagcaatcgt ttggacagct agcgagccat       420
     atgattaacc agcattaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page