(data stored in ACNUC7421 zone)

EMBL: CR954246.PE300

CR954246.PE300       Location/Qualifiers
FT   CDS_pept        329457..330395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0315"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85414"
FT                   /db_xref="GOA:Q3ILC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC1"
FT                   /protein_id="CAI85414.1"
FT                   /translation="MTNLPSIKQLQYLLAVHQYQHFGRAASACFIGQSTLSTAIQNLEE
FT                   TLGCQLIERENRSLMFTTIGEEVVERSRKIIHDTISLKELTKSFLTPLSGKLTVGVIPT
FT                   IASFIAAPLYHFCKQEFCDLELVLVEDTSDKLLDKLEHGQIDLALLALPYQTDKFHTQV
FT                   LARDHFSLVHHKDYTPAKNVQDFNLLPDASVFLLEREHCMTGHALSACHLNRVSCINPF
FT                   EAASLHTLLSMVEYQLGVTFLPQMAINAGILDNKNMLATPSANEAYREIGILWRKTTGR
FT                   IRDFKLFSQQLEVFLKHQCSLDFAKEAATSS"
     atgactaatc ttccgagtat aaaacagctg cagtatttac ttgcagtaca tcaatatcaa        60
     cattttggcc gcgctgctag tgcgtgcttt attggccaat caacattaag tacagccatt       120
     caaaacttag aagaaacact aggctgccaa cttattgaac gtgaaaaccg cagtttaatg       180
     tttaccacca ttggtgagga agtagttgaa cgttcgcgca aaattattca cgacacaatc       240
     agtttaaaag agctcactaa aagcttttta acgccgctga gtggtaagtt aaccgtaggg       300
     gttattccta ctattgcgag ctttattgcc gcgcctttgt atcatttttg taagcaagaa       360
     ttttgcgatt tagaactggt attagtagaa gatactagcg ataagttact cgataaatta       420
     gagcatggtc agatagattt agccttatta gcactgccgt atcaaaccga taagtttcat       480
     actcaggtgt tagctagaga tcattttagt ttggtacatc acaaagatta cacgccagca       540
     aagaacgtgc aagactttaa cttattaccc gacgccagcg tgttcttact agaacgtgag       600
     cactgtatga ccgggcacgc gcttagtgca tgtcatttaa accgtgtcag ctgtataaac       660
     ccgtttgaag cagccagctt gcatacttta ttgagcatgg tggagtatca gttgggggtg       720
     acctttttac cgcaaatggc gattaatgcc ggcattttag ataataaaaa tatgctagca       780
     accccatcgg cgaatgaggc ataccgtgaa attggtattt tgtggcgtaa aacaaccgga       840
     cgaattcgcg actttaaatt gttcagccag caattagagg tgtttttaaa acaccagtgt       900
     agtttagact ttgctaaaga ggcagcaaca agcagctaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page