(data stored in ACNUC7421 zone)

EMBL: CR954246.PE301

CR954246.PE301       Location/Qualifiers
FT   CDS_pept        complement(330392..330604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0316"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85415"
FT                   /db_xref="GOA:Q3ILB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB1"
FT                   /protein_id="CAI85415.1"
FT                   /translation="MTQLVVLLLLMHFAIAFQCYRYAHIKGYPVRVFTVLGLVPYFNLV
FT                   VWVYLLFLPKLEPYESHNHENKQLS"
     atgacacagc tagttgtttt attactactt atgcattttg caattgcgtt tcagtgttac        60
     cgatatgcac acattaaagg ttatccggtt cgggtattta ctgtattagg gctagtgcct       120
     tactttaatc tggttgtttg ggtttatttg ctttttttac ctaaactaga accatatgaa       180
     agccataacc atgaaaacaa gcagctatct tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page