(data stored in ACNUC7421 zone)

EMBL: CR954246.PE302

CR954246.PE302       Location/Qualifiers
FT   CDS_pept        complement(330808..333339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0317"
FT                   /product="putative orphan protein ; putative sensory-box
FT                   domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85416"
FT                   /db_xref="GOA:Q3ILC0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC0"
FT                   /protein_id="CAI85416.1"
FT                   /translation="MVNQLKLLILNASSAERGTIRATLEKLNVFEFIEVSDSQQALKIL
FT                   KKQAVNIIITGLDVGKIDGWRFSRMIRSGLLNTPKNTPILLIPPIYCERIAETTARSYG
FT                   IDAVLPFERQDMLPQVLASVLANHLEKSSRLNLLLLEPTNTKANEISKPLLLNFSITHV
FT                   TSSQAALNAYNQQQFAIVLLDATAARAEESSVLVSEILQHNPMQAIVTIIDSDDADYAE
FT                   QLLLSGVTDFIRAPYDPPFLNKVCDHAARREDFMVSYAEFANKVEQLSISEVRYRDLFS
FT                   AHQRILLHLNTVVLELDQQGLIRFINPAWEALSGFGVKSTLQQQLTNFCIAECQVKLQA
FT                   TIDDILCGGEYKQQVEIRLQHKNGSQIWVECRLQLIQNSHNNATITATIDNIHERKQAE
FT                   LQLRHLALHDTLTGLHNRYYFDQQLNRICQPQHTHSDIEHALIYIDLDHFKIINDSKGH
FT                   QQGDIVLKEVAQLFITNISTEHLVFRVGGDEFAVILKHTNLLDAHLIAEGICNAIEQNQ
FT                   FKSEEQIYSISCSIGLTQITEKNCDPSECLKQADIALYIAKNLGRNLVHCYAKQDAHNN
FT                   TLQTGLEWGHGIRQALQQDSIELHYQPIWDFRRNEVAYFEVLLRLKINDELVFPNQFIP
FT                   SLEMLNDTFLMDQCVIRNTIANVALYPELNQVAINLSAQSFLDERLVPLIESNLAKYQV
FT                   LPTQIIFEITESASINNLAATRKMIEKLNILGCHFSIDDFGTGFSTFNYLKQLPAQHVK
FT                   IDGSFVCDMLNDPIDLALVKAINDISHSLDKRSVAEYVETEEVFFALKEIGVDYGQGYF
FT                   IARPMPIKGVKSELEKILKNKTFYQQLPSKK"
     gtggtaaatc agcttaaatt gctaatatta aacgccagca gtgctgagcg tggcactatt        60
     cgagccactt tagagaaatt aaatgttttt gaatttatag aagtatctga tagccaacaa       120
     gctttaaaaa tattaaaaaa acaagccgtt aatataatta ttaccggcct tgatgtaggt       180
     aaaattgatg gctggcgctt ctcaagaatg atccgctcgg gcttattaaa cacccctaaa       240
     aacaccccaa tcttacttat tccccctatt tattgtgaac gaatagctga aactactgcc       300
     cgcagctacg gtattgatgc agtattacct tttgagcgcc aagacatgct gccgcaagtg       360
     ctggcaagtg tgctcgctaa ccatttagaa aaaagcagtc gtttaaacct cttactgtta       420
     gagccgacta acactaaagc caatgaaatc agcaagccgt tactgctaaa cttttcgatt       480
     acccatgtta cctcgagcca agccgcgctt aatgcttata accagcaaca atttgcaatt       540
     gttttacttg atgcaaccgc tgcaagagca gaagagtcga gcgtgctagt atctgaaatt       600
     ttacaacata atcctatgca agcaattgta actattatag atagtgatga tgcagattat       660
     gcggagcagc ttttactttc gggtgtcacc gactttatac gtgccccata cgatccgcca       720
     tttttaaata aagtatgcga ccatgcagcg cgtcgcgaag actttatggt gagctacgct       780
     gaatttgcta acaaagtaga gcaactgagc ataagcgaag tgcgataccg agatttattt       840
     tctgcgcatc aacgtatttt attgcattta aatactgtcg ttctagaact tgatcagcaa       900
     gggcttattc gctttatcaa cccagcgtgg gaagcattaa gtggctttgg cgttaaatcg       960
     acactacaac agcaattaac taatttttgt attgctgaat gccaagtaaa actacaagca      1020
     acaatagacg acattctttg tggtggtgag tacaaacaac aagttgaaat aaggctacaa      1080
     cataaaaatg gcagccaaat ttgggttgaa tgtcggctac agctcataca aaacagccat      1140
     aataacgcca ctattaccgc cacaatcgac aatattcatg aacgaaaaca agcggaactg      1200
     cagctgcgcc atttagcact tcacgatacg cttactggcc tgcataatcg ctattacttt      1260
     gaccaacagc tgaatcgtat ttgccaacct cagcacaccc attctgatat tgagcacgcg      1320
     cttatttata tcgatttaga tcactttaaa ataattaacg acagtaaagg ccatcaacaa      1380
     ggcgatattg ttttaaaaga agtagcgcaa ttatttataa caaacataag taccgagcat      1440
     ttagtgttta gagttggtgg cgacgaattt gcagtgatcc tcaaacatac taacttgctt      1500
     gacgcgcatt taattgccga aggtatatgt aacgcgattg aacaaaatca atttaaatct      1560
     gaggagcaaa tatactcaat cagttgctca attggtttaa ctcaaattac cgaaaagaat      1620
     tgcgacccga gcgaatgttt aaaacaagct gatattgccc tgtatatcgc taaaaattta      1680
     ggtcgtaatt tagtacattg ctatgcaaaa caagatgccc ataacaatac gctacaaacg      1740
     ggtttagagt ggggtcatgg tattcgccaa gcgctacaac aagacagcat tgaactgcat      1800
     taccaaccaa tttgggattt taggcgcaat gaagttgctt actttgaggt gctgctgcgc      1860
     ttaaaaataa atgatgaact agtttttcct aatcaattta ttccttcatt agaaatgcta      1920
     aacgatactt ttttaatgga tcaatgcgtt attcgtaaca ccattgctaa tgttgccctc      1980
     tacccagaac ttaaccaagt agctataaat ctctctgcgc agtcattttt agatgagcgt      2040
     ttagtgccat taatagagtc aaatttagca aagtatcagg ttttaccaac acaaataatt      2100
     tttgaaatta ccgaatctgc cagcattaac aacttagcag ctacgcgtaa aatgattgaa      2160
     aaactcaata ttttaggctg ccacttttcg attgacgatt ttggcaccgg cttcagtact      2220
     tttaactact tgaaacaact gccagcacag catgtaaaaa ttgatggctc gtttgtttgc      2280
     gatatgctca acgaccctat tgatttagca ctagtaaagg ccattaacga cattagtcat      2340
     tcactcgata agcgctctgt ggctgagtat gtagaaaccg aagaagtatt ttttgcatta      2400
     aaagaaattg gcgttgacta cggccaaggc tattttatag ctcgccctat gcctattaaa      2460
     ggtgttaaaa gtgaacttga aaagatttta aaaaataaaa cgttttacca acaactacct      2520
     agcaaaaaat aa                                                          2532
//

If you have problems or comments...

PBIL Back to PBIL home page