(data stored in ACNUC7421 zone)

EMBL: CR954246.PE309

CR954246.PE309       Location/Qualifiers
FT   CDS_pept        complement(340400..341065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0324"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85423"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB3"
FT                   /protein_id="CAI85423.1"
FT                   /translation="MSVKITDRPQEQVREEVIDQLIYNYSHGVISVEAFERRLDEAMAT
FT                   NNNEVLVSLVEDLTLNTDQQYNAQKHSQFSPNYSAQQFSQSDFTLRSILGSNERSGQWI
FT                   VPKNIYLTNFMGSVVLDFTDAIFTHQEITIHVNCIFGSDEIYVPEHVNVVSKMFSIISS
FT                   VENKTVALNKHQGPTIHIEGKAIMGSVEIKIKRTIKEKFISFANQLKTQLGGKSGTPM"
     atgagcgtaa aaataacaga ccgcccgcaa gagcaagtgc gcgaagaagt gattgatcaa        60
     ctaatttata attacagcca tggagttatt tctgtagaag catttgaaag gcgtttagat       120
     gaggcaatgg ctacaaataa taatgaagtc cttgttagct tagttgagga tttaaccctt       180
     aatactgatc agcaatataa tgcccaaaaa cattcgcaat tttcacccaa ttacagcgct       240
     cagcaattta gccagagtga ctttacatta cgcagtattt taggctccaa tgaaagaagt       300
     ggccagtgga ttgtgcctaa aaatatttac ctgactaact ttatgggctc ggtagtactt       360
     gattttaccg atgctatttt tacccaccaa gagataacga ttcatgttaa ctgtattttt       420
     ggcagtgatg aaatatacgt accagaacac gttaatgtag tatcaaaaat gtttagcatt       480
     attagtagtg ttgaaaataa aacagtggca cttaacaagc atcaaggccc gaccatccat       540
     attgagggaa aggctattat gggctcggta gaaataaaga ttaagcgcac cattaaagaa       600
     aaatttatta gctttgctaa ccaattaaaa acccaacttg gtggtaaaag tggtactcca       660
     atgtga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page