(data stored in ACNUC7421 zone)

EMBL: CR954246.PE312

CR954246.PE312       Location/Qualifiers
FT   CDS_pept        342908..343633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0327"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85426"
FT                   /db_xref="GOA:Q3IFS1"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS1"
FT                   /protein_id="CAI85426.1"
FT                   /translation="MTPEELEQQAITFAKSNRTRIARKLTDKNEFPSDIRPVSVFMSGS
FT                   PGAGKTETSKAFLEEIGADNVLRLDPDELRELIPGYSGDNSYLFHRAVSFIVERTLDHA
FT                   FKNKQSFLLDGTLASYDVAKKNIERSIRKGRQVLILFVYQKPELAWEFVEAREKLEGRR
FT                   ILPNIFIDQFFASQEVIRELKLNFGSQIQVDLLVKNNKGKTRFYHGNVQAIEHHLDEKF
FT                   TREDLESLIESPSSSKNEL"
     atgacaccag aagaactaga gcagcaggct ataacttttg caaaaagcaa tagaacacgt        60
     atagctcgca aactaacaga taaaaacgag ttcccttcag acataaggcc tgtttctgtt       120
     tttatgtcag gttcaccagg tgcaggtaaa actgagacat caaaagcttt tttagaagaa       180
     attggagctg ataatgtact aaggcttgat cctgatgagc taagagagct tatacctggt       240
     tattcaggtg ataactcgta tttatttcat cgcgcagttt cttttatcgt agagcggaca       300
     cttgaccatg cgtttaaaaa caagcagtct tttttgttag atggaacttt ggcaagctat       360
     gatgttgcaa aaaagaatat tgaacgctct attcgcaagg gaaggcaggt acttattttg       420
     tttgtatatc agaagccaga actcgcttgg gagttcgttg aggcaagaga aaagctagaa       480
     gggcgtagaa ttctaccaaa tatcttcatt gatcagttct ttgcctctca ggaggttata       540
     agggagctta agttaaattt tggtagtcaa atacaagttg atttattagt taaaaataac       600
     aaaggtaaaa ctcgttttta tcacggtaat gttcaggcta tagagcatca tttagatgaa       660
     aaattcacta gagaagatct ggagagcctg atagaatcac catccagctc aaaaaacgag       720
     ctttag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page