(data stored in ACNUC7421 zone)

EMBL: CR954246.PE313

CR954246.PE313       Location/Qualifiers
FT   CDS_pept        343642..343809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0328"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFS0"
FT                   /protein_id="CAI85427.1"
FT                   /translation="MFSNLIKPKPTQNSKLSDFVLDSSSSEKKRVYSQVIERAISSQVQ
FT                   VVNKASAIQR"
     atgttttcaa atttaattaa gccaaagcca acgcaaaact ctaagctttc agactttgtg        60
     ttagattcta gctcaagcga gaagaagcga gtttatagcc aagttattga gcgagctatt       120
     tcttcccagg ttcaagtcgt aaataaagct tcagctatcc aaagataa                    168
//

If you have problems or comments...

PBIL Back to PBIL home page