(data stored in ACNUC7421 zone)

EMBL: CR954246.PE314

CR954246.PE314       Location/Qualifiers
FT   CDS_pept        complement(343957..344286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0329"
FT                   /product="putative 5-carboxymethyl-2-hydroxymuconate delta
FT                   isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 2194841; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85428"
FT                   /db_xref="GOA:Q3IFR9"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR9"
FT                   /protein_id="CAI85428.1"
FT                   /translation="MPHIIIEHSEDLPVLPQVLVEKIHNAAFQSNLFDLETIKTRAISY
FT                   QQYLLGAGGSGFIHIAVHILAGRSIEQKQMLSEQLLECLKTYCRASDSLSVNIYDIEHE
FT                   IYRKN"
     atgccgcaca ttattattga acactcagaa gacctccctg tattaccaca agtacttgta        60
     gaaaaaattc acaacgccgc tttccaaagt aatttatttg atttagaaac cataaaaaca       120
     cgcgctattt cctatcagca atatctactt ggcgcaggcg ggtcggggtt tatacatatt       180
     gcggtacaca ttttggcggg gcgttctatt gagcaaaagc aaatgttaag tgagcaacta       240
     cttgagtgtt taaaaaccta ttgcagagca tcagacagtt taagcgttaa tatttacgat       300
     attgaacatg agatctaccg taaaaattaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page