(data stored in ACNUC7421 zone)

EMBL: CR954246.PE315

CR954246.PE315       Location/Qualifiers
FT   CDS_pept        344318..344506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0330"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85429"
FT                   /db_xref="GOA:Q3IFR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR8"
FT                   /protein_id="CAI85429.1"
FT                   /translation="MNLIIPNTRLPANPYNAELASFCFAQLAIKKCYGAAKVNVYSVMF
FT                   IFYNMCFVAVNTFSIEK"
     gtgaacctta ttataccaaa taccaggtta cccgctaacc cctacaatgc tgaattagca        60
     tctttttgtt ttgcacaatt agccattaag aagtgttatg gtgcggcaaa ggtgaatgta       120
     tatagcgtaa tgtttatttt ttataacatg tgttttgtag ctgtaaatac gtttagtata       180
     gaaaaataa                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page