(data stored in ACNUC7421 zone)

EMBL: CR954246.PE316

CR954246.PE316       Location/Qualifiers
FT   CDS_pept        344541..345017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0331"
FT                   /product="conserved protein of unknown function ; putative
FT                   CreA protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85430"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR7"
FT                   /protein_id="CAI85430.1"
FT                   /translation="MKYLKVSFLLAGILTLTACSDDVASVSLGLFTTKDVIVNSQQDPL
FT                   VTGVTCHISHIEANLDFSDPSDMSISCRQTGVITAEQLQQIDRSKSGEVVFKSSKSILF
FT                   KSLKVRRIYDAKAHTLLYLSYSTKESTGSHHHALSTVPLYNTQAWQWALGQERE"
     atgaagtatt taaaagtcag ctttttactc gcaggtatac ttaccttaac agcgtgctca        60
     gatgatgttg cctctgtaag ccttgggtta tttaccacca aggatgtaat tgtaaattcg       120
     caacaagacc ctttagtcac tggggtaacg tgccatatta gccatataga agctaattta       180
     gatttttcag acccttctga catgtcaatt tcgtgtcggc aaaccggggt tattaccgca       240
     gagcaattgc agcagattga tcggagtaaa tctggagaag tggtatttaa atcatctaaa       300
     agtattttgt ttaaatcatt aaaagtgcgt cgtatttacg atgctaaagc acatacctta       360
     ctgtatttgt cgtactcgac taaagagtct acggggagtc atcatcatgc gttatctact       420
     gtaccattat acaatacaca agcatggcaa tgggcgcttg ggcaagagcg agagtaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page