(data stored in ACNUC7421 zone)

EMBL: CR954246.PE317

CR954246.PE317       Location/Qualifiers
FT   CDS_pept        345021..345794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0332"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85431"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR6"
FT                   /protein_id="CAI85431.1"
FT                   /translation="MLALFKPKPLLAEQEQQWLIDTFIWAVENFDVEFFTQHTQITLPT
FT                   VEFFPDSVSSIEEMATKVFNRVSSYAGMTAWPIQLVAPQQLTPQVFPQFKFSQQLRGEG
FT                   AKLIVPPSQAINISFNPNQVNQPQDLVASFAGTLATILIHHVGVLPPGGKDYLAQAADA
FT                   LACFLGFGVMMSNTVYQFKGGCGSCYNPYANREASLSETHTVFMHALVSYFKNDKRSKQ
FT                   HLKPHLRGQFKKAQKEIKALVNNSANPLLLAYMPN"
     atgttagcgt tatttaagcc caaaccatta ctggctgagc aagagcagca atggttaatt        60
     gataccttta tatgggcagt tgaaaacttt gatgttgagt tttttaccca gcatacgcaa       120
     atcactttgc ccacggttga gttctttccc gactcggtat cgagtattga agaaatggcc       180
     actaaggtat ttaaccgcgt aagcagttat gcgggtatga cagcgtggcc cattcaacta       240
     gttgcaccgc agcagctcac tccacaggtt tttccacagt ttaaatttag ccaacaacta       300
     cgtggcgaag gcgctaaatt aattgtaccg cctagccagg ctattaatat ttcgtttaat       360
     ccaaatcaag taaaccagcc acaagactta gttgccagtt ttgctggaac attagcgact       420
     attttaattc atcatgtagg cgtattacca ccgggcggaa aagactactt agcgcaagct       480
     gctgatgcac tggcttgctt tttaggcttt ggggtaatga tgagcaatac ggtatatcag       540
     tttaagggcg gctgtggctc gtgttataac ccttatgcaa atcgcgaagc gtcgttgagc       600
     gaaacccata cggtatttat gcatgcgtta gtgagctact ttaaaaatga taaacgctct       660
     aagcagcatt taaagccgca tttgcgcggc caatttaaaa aagcgcaaaa agaaattaaa       720
     gcattagtca ataactcagc taacccgctg ttattagcgt atatgccaaa ctaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page