(data stored in ACNUC7421 zone)

EMBL: CR954246.PE318

CR954246.PE318       Location/Qualifiers
FT   CDS_pept        345808..346434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0333"
FT                   /product="putative transporter"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85432"
FT                   /db_xref="GOA:Q3IF04"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF04"
FT                   /protein_id="CAI85432.1"
FT                   /translation="MNYLDEFLLIAVAHFFAVASPGPDFAVVLKQSVQQGRRNALWTSA
FT                   GVGAAILLHVAYCVLGVALILTQSPKVFMGLKYLAGAYLAYLGVQALRAAKPGANLNDN
FT                   IANKTVPAEPVWFAFRRGFLTNALNPKATLFFMSLFTLVISPATPTIVQVSYGVYMALA
FT                   TWAWFSMLSIVLCKTKVRGFFQRSGYWFERCIGVILIALAIRVVI"
     gtgaattact tagacgaatt tttactgatt gccgtagcgc acttttttgc agtagcaagc        60
     ccagggcccg attttgctgt ggtattaaag caaagtgtgc agcaaggtag gcgcaatgct       120
     ctttggacta gtgcaggtgt tggtgcggct attttattac atgtagctta ttgcgtgtta       180
     ggtgtagcac ttattttaac gcagtcgccc aaggtgttta tggggcttaa atacttggcc       240
     ggtgcctatt tagcttattt gggagtgcaa gcactgcgag cagccaaacc gggggcaaat       300
     ctaaatgata atattgccaa caaaacggtg ccagcagagc ccgtttggtt tgcctttcgg       360
     cgcggttttt taaccaatgc attaaaccct aaagccacct tgttttttat gtcgctattt       420
     actttagtca taagcccagc cacccctaca atagtacaag taagttatgg cgtttatatg       480
     gcactggcta cctgggcgtg gttttcaatg ttatcaatag tgctttgtaa aactaaggta       540
     cgtggctttt tccagcgcag tggttattgg tttgaacgct gcattggcgt tattttaata       600
     gctttggcta ttcgtgttgt aatttaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page