(data stored in ACNUC7421 zone)

EMBL: CR954246.PE319

CR954246.PE319       Location/Qualifiers
FT   CDS_pept        346469..346963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0334"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85433"
FT                   /db_xref="GOA:Q3IF03"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF03"
FT                   /protein_id="CAI85433.1"
FT                   /translation="MSLYNFSFGSNMSSHRLLARLPNAKRIGTAVLQGYELTFDMYFKD
FT                   GSGKCSISPSDAEDALVYGVVYQISDAEKVILDGIEGAGYDCVNITVKLLSGEDVNAHC
FT                   YIANTHDSEALPYDWYIKHVHRGALEAGVPKAYSDAILNRAQKSDSNLERAEIEFAVHQ
FT                   K"
     atgtcgcttt ataatttttc gtttggttct aacatgtcgt ctcaccgttt actggcgcgc        60
     ctgcctaatg ctaagcgcat tggtacagcc gtattacaag gttatgagct aacctttgat       120
     atgtatttta aagatggctc aggtaaatgc agtattagcc caagtgatgc agaggatgcg       180
     ttagtttatg gggttgttta tcaaataagt gatgccgaaa aagtcatttt agatggtata       240
     gaaggtgcag gttacgactg cgtaaatata accgtaaagc ttttaagcgg cgaagacgtt       300
     aacgctcatt gctatattgc caatacccac gatagtgaag cgctacccta cgactggtat       360
     attaaacacg ttcatcgcgg cgcgcttgaa gctggcgttc caaaagcata cagtgatgca       420
     atattaaacc gcgcgcaaaa aagcgacagt aacctagagc gtgctgaaat tgaatttgca       480
     gtacatcaaa aataa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page