(data stored in ACNUC7421 zone)

EMBL: CR954246.PE32

CR954246.PE32        Location/Qualifiers
FT   CDS_pept        33743..33997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0032"
FT                   /product="putative unknown membrane associated protein
FT                   YrdB"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85146"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI5"
FT                   /protein_id="CAI85146.1"
FT                   /translation="MNQAIQFIDRLEFREPAHQLVFFAQVNGMLVECVIAVSSLGLTDE
FT                   SHATSYFEKNRFDYEERAEQLIEDESYNSAGQIEVSLIS"
     atgaaccaag caatacaatt tatagatagg ttagaattta gagagccagc gcaccaatta        60
     gtcttttttg cacaagtaaa tggcatgctg gtggaatgtg ttattgcggt aagtagttta       120
     ggtttgaccg atgaaagtca tgcaacaagt tattttgaaa aaaatcgttt tgattacgaa       180
     gagcgcgccg agcaacttat cgaagatgaa agttacaact cggcaggcca aatagaagtc       240
     agcttaatta gctaa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page