(data stored in ACNUC7421 zone)

EMBL: CR954246.PE321

CR954246.PE321       Location/Qualifiers
FT   CDS_pept        348643..349563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0336"
FT                   /product="putative histone deacetylase family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85435"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF01"
FT                   /protein_id="CAI85435.1"
FT                   /translation="MRTAIISHPHCRKHKMIDDHPECPERLDAINDRLLASGLDIAIEQ
FT                   KQAPKAQREHYLLAHDESLVSFVESKIPTQGLVDLDGDTWLCPDSLKAIERAVGAGILA
FT                   VDEILEGNLDAAFCSVRPPGHHANRTTSSGFCVFNNLAIAVKYAQSKGVKRIAIVDFDV
FT                   HHGNGTQDIFIDDKNVLFCSLFQHPFYPNTVVENNTTLVNSPLPIASDGNDLKAVFEQQ
FT                   WLPKLNAFKPDMLFISAGFDAHLEDDMASLKFVEEDYRWLTEQLARFSEQHNCRGIVSY
FT                   LEGGYALSALGRSAIAHVKALVDYE"
     atgcgtaccg caattatttc tcaccctcat tgtcgtaaac ataaaatgat tgatgatcac        60
     ccagagtgcc cagagcggtt agatgccatt aacgatcgct tactagcaag cgggttagat       120
     attgctattg agcaaaaaca agcgcctaaa gcgcaacgag agcattactt acttgcgcat       180
     gacgaatcat tagttagctt tgttgaaagt aaaataccta cccaagggct tgtcgattta       240
     gacggtgata cttggttatg tcccgattca ttaaaagcaa ttgagcgtgc agtaggggcc       300
     ggtattttag cggtagatga aatactagag ggcaaccttg atgctgcatt ttgctcggtg       360
     cgcccgccgg ggcatcatgc aaatcgcact acctcatccg gtttttgtgt atttaacaac       420
     cttgctattg cggttaaata tgcacaaagc aaaggggtta agcgcattgc tattgttgat       480
     tttgatgtac atcatggtaa tggcactcaa gatatattta tagatgataa aaacgtcctg       540
     ttttgctctt tatttcagca tccattttat cccaatacag tggttgaaaa taacaccacg       600
     ttagttaatt cacctttgcc aattgccagc gacggtaacg atttaaaagc ggtatttgag       660
     cagcaatggc tgcctaaact aaatgctttt aagcctgaca tgttatttat tagcgcagga       720
     tttgatgctc acctcgaaga tgatatggct agtttaaagt ttgtagagga agattaccgc       780
     tggctaaccg agcaattagc ccgctttagc gagcagcata attgccgtgg tatagtgtcg       840
     tatttagaag gggggtatgc gctttctgca ttgggtcgca gtgcaattgc acatgtaaaa       900
     gcgttagtcg attatgagta a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page