(data stored in ACNUC7421 zone)

EMBL: CR954246.PE322

CR954246.PE322       Location/Qualifiers
FT   CDS_pept        complement(349546..349836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0337"
FT                   /product="putative orphan protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85436"
FT                   /db_xref="InterPro:IPR025284"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF00"
FT                   /protein_id="CAI85436.1"
FT                   /translation="MSYPKIIIYNNEIELAEQPDEVDDFVYAMDELQKSRIIILDSKYS
FT                   YTTLSGEPKTAISAIELADLVKDYLLKEGQCCLSKIKQLTPEQAFALLIID"
     atgtcgtatc caaaaattat tatttataac aatgaaattg agttagctga gcagcctgat        60
     gaagtagatg attttgtata tgcgatggat gagctgcaaa aaagcagaat tattatttta       120
     gatagtaagt atagttatac aacattaagt ggcgagccaa aaacagccat tagtgccatt       180
     gaattagcag atttagtgaa agattatttg ctaaaagaag gtcagtgttg cctaagtaaa       240
     attaagcagc taacacctga gcaagcattt gcgttactca taatcgacta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page