(data stored in ACNUC7421 zone)

EMBL: CR954246.PE323

CR954246.PE323       Location/Qualifiers
FT   CDS_pept        349919..352447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0338"
FT                   /product="conserved protein of unknown function; putative
FT                   signaling protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85437"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ9"
FT                   /protein_id="CAI85437.1"
FT                   /translation="MPHSSRFQKVGDIFTNKVITCSKHTPLIDAVKLMRAHNISAIFIA
FT                   QQQRILGVWTETDCLKLDFTNPAVTSTSIKDVMTSPVLSVPSQQLLSDTALTFHQHGVR
FT                   HLLVTDNNNVPCGVISITDIVRNQGLDHYLQFRTINDQYTKNITIVPSSLALNEAVKLM
FT                   RERSEKVILVFNQQQKEHGIITQRDLLQLITRQSEQSVCWDLASRPLYKITPQDSLFDA
FT                   YKLMLDSQVRHLVVSDKDEIKGVLSLEHLIHEIESAYCSELEKVLVQRDLALQHSQRNL
FT                   YLANKIIDSSLDGIMITHSNSTIMQVNPAFTQLTGYKEHEVIGKCPSILSSGRHDKSFY
FT                   IKMWDAINKTGVWQGEICNRKKNGDIYIEWLTIIEIKEPNNSDAIYAAIFSDITERKNA
FT                   EDKIVQLAYFDELTGLPNRRLFNDRLKMALAAAHRDQHLLAVMFIDLDRFKEVNDSLGH
FT                   SAGDCLLTLVAARIEATLNEGDTLARLGGDEFVVLCEINKIDAVASLADKILNNLNSPF
FT                   QLDHVEVGVTASIGAAVYPDDGLDSETLLKHADIAMYRSKDVGRNSFQLFKPSMNARSL
FT                   ERLAMMSRFQHALDNNEFELYFQPKQCLKSEQIMGVEALLRWHDPDLGMISPAQFIPLA
FT                   EELGLIVRLDLWVINQAGKVLTLWQKEGLVAGRLAINISACHLSQGKLANNIGTMLKHY
FT                   NLPGSLLEIELTESSFISSFTQAKTQLQQLKKLGVHIALDDFGTGYSALSYLTKLPFDT
FT                   LKIDASFIAKIPDEYGNSQIVAALIALASNLNLMVVAEGVEQPAQKNYLISLGCNVIQG
FT                   YYYCRPLTQRQWFDFYRLNDLSASTQPTGT"
     atgccacaca gtagccgttt tcaaaaagta ggtgatattt ttactaataa ggtaataacc        60
     tgtagcaagc atacgccatt aattgatgcg gttaaactaa tgcgggcaca taatatcagt       120
     gcaatattta ttgcgcagca acaacgcata ttaggtgttt ggacagaaac tgactgttta       180
     aaactcgact ttaccaatcc tgcagttaca agcactagca ttaaagatgt gatgacgagc       240
     ccggttttaa gtgtccctag ccagcagtta ttaagtgata ccgcactaac ttttcatcag       300
     catggtgtaa ggcatttact tgttaccgat aacaataacg taccgtgtgg ggtaattagc       360
     attacagata ttgtgcgcaa tcaagggctt gatcattact tacagtttcg cactattaac       420
     gaccagtaca ctaaaaacat aacaattgta cctagctcat tagcgctaaa tgaagcggtg       480
     aaattaatgc gcgaacgcag cgaaaaagtt attttagttt ttaatcaaca gcaaaaagaa       540
     catggcatta ttacgcagcg cgatttatta caactgatca cacgccagag cgagcagagt       600
     gtgtgctggg atttagcaag tcggccgctt tataaaataa ccccacaaga tagcctgttt       660
     gatgcttaca aattaatgtt agatagccaa gtacggcatt tagtggtgag cgacaaagat       720
     gaaattaaag gcgtgttgtc actcgaacat ttaatacatg aaattgaaag tgcgtattgt       780
     tctgagctag aaaaagtatt agtgcaacga gatttagccc tacagcactc gcagcgaaac       840
     ctatatttag ccaataaaat aatagattca tcactcgacg gcataatgat cacccatagc       900
     aacagcacta ttatgcaagt aaacccagca tttacccaat tgaccggcta taaagaacat       960
     gaagttatag gtaagtgccc aagtatattg agctctgggc ggcatgataa aagcttttat      1020
     ataaaaatgt gggatgcaat caacaaaacg ggcgtgtggc agggagaaat ttgtaatcgt      1080
     aaaaaaaatg gcgatattta tatagagtgg ttaactataa ttgaaattaa agagcctaat      1140
     aattcagatg ctatttatgc ggcaattttt agtgatatta ccgagcgaaa aaatgctgaa      1200
     gataaaattg tgcagttggc ttattttgat gaattaacgg gcctaccaaa tagacgtttg      1260
     tttaacgaca ggctcaaaat ggctttggct gcagctcacc gcgaccagca tttattggcg      1320
     gtgatgttta tcgatctaga tcgctttaaa gaagtaaacg atagtttagg ccatagcgca      1380
     ggggattgtt tattaactct ggttgctgcg cgtatcgagg ctactttaaa cgaaggcgat      1440
     accttagcgc gtttaggggg agatgaattt gtagtgctgt gcgaaataaa taagattgat      1500
     gcagtagcta gtttagctga caaaatacta aataacttaa actctccgtt tcaattagac      1560
     catgttgaag taggtgtaac agcttcgatt ggcgcggctg tttaccctga tgatggccta      1620
     gacagcgaaa cactgctaaa gcatgccgat attgctatgt atcgctcaaa agatgtgggg      1680
     cgtaattcgt ttcaattatt taaaccttct atgaatgctc gctcgctaga gcgcctagcc      1740
     atgatgagtc gttttcagca tgcgttagat aataacgaat ttgaattgta ttttcagcca      1800
     aaacaatgcc ttaaaagtga acagattatg ggcgttgagg cattattgcg ttggcacgac      1860
     cccgatttgg gaatgatatc gcccgcgcaa tttattccgc ttgctgaaga gctagggttg      1920
     atagtgcggt tagatttatg ggttattaat caggcgggta aagtactaac gctatggcaa      1980
     aaagaaggac tggtggctgg gcgcttagca attaatatat cggcatgtca tttaagccaa      2040
     ggcaagctgg caaacaatat tggcactatg cttaaacatt ataatttacc cggtagttta      2100
     cttgaaatag aactgacaga aagcagcttt attagctcat ttacacaggc taaaacgcag      2160
     ttgcagcagc taaaaaagct gggcgtgcat atagcattag acgactttgg taccgggtac      2220
     tcggcattga gttatttaac taaactgcct tttgatacat taaaaataga cgcgagcttt      2280
     attgctaaaa tccctgatga atacggcaat agccaaatag ttgcagcgct tattgcactg      2340
     gcaagcaatt taaacttaat ggtagtggca gagggagttg agcagccagc tcaaaaaaac      2400
     taccttatta gcttagggtg taatgttata caggggtatt actattgccg cccgttaacg      2460
     cagcggcaat ggtttgattt ttatcggtta aacgacttat ctgcgagcac tcaaccaact      2520
     ggcacttag                                                              2529
//

If you have problems or comments...

PBIL Back to PBIL home page