(data stored in ACNUC7421 zone)

EMBL: CR954246.PE324

CR954246.PE324       Location/Qualifiers
FT   CDS_pept        complement(352444..353253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0339"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85438"
FT                   /db_xref="InterPro:IPR021246"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ8"
FT                   /protein_id="CAI85438.1"
FT                   /translation="MQGTLRKLKSSLTEPVQYHLPVGEHLVDLNAFIGKELTLTFSGTI
FT                   LCSSCGKKTKKSYSQGHCFVCMRKLASCDMCIMKPETCHYDQGTCREPEWGEENCMIPH
FT                   YVYLANTSGLKVGITRHTQIPTRWVDQGATQALPIFKVQTRLQSGLVEVALAEFIADKT
FT                   NWRNMLKGQNEALDLKAAAAELIPQISAKLNELSELFGATAIEQLDEDVVDLNFPVSEY
FT                   PTKISSFNFDKDPVVSGVLQGIKGQYLIFEKGVINIRKFTSYEVTVG"
     atgcaaggca cattgcgtaa attaaaatcg agcttaaccg agccggtaca atatcactta        60
     cctgtgggtg agcacttagt cgacttaaat gcatttatag gtaaagagct aacgcttact       120
     tttagcggca caattttatg ctctagctgt ggtaaaaaaa ccaaaaaaag ctattctcaa       180
     ggccattgct ttgtatgcat gcgcaaactt gctagttgcg atatgtgtat tatgaagcca       240
     gaaacctgcc attacgatca aggtacttgc cgcgagccag agtggggaga agaaaattgc       300
     atgatcccgc attacgtcta cctcgctaat acctcaggac taaaagtggg tattactcgc       360
     cacacgcaaa taccaactcg ctgggttgat caaggcgcta cccaagcatt gcctattttt       420
     aaagtgcaaa cacggttgca atcaggctta gtagaagtgg cattggctga atttattgct       480
     gataaaacta attggcgcaa tatgctaaaa ggccaaaacg aagcgctaga tttaaaagct       540
     gcagccgctg agcttattcc acaaattagt gcaaagctaa atgagctaag cgagctattt       600
     ggcgcaacag ctattgaaca gctagatgaa gacgtagttg atttaaactt tccggtaagc       660
     gaatacccaa ccaaaatcag ctcgtttaac tttgataaag acccggtagt aagcggtgtt       720
     ttacaaggca ttaaaggtca gtatttaatt tttgaaaaag gcgttattaa cattcgaaaa       780
     ttcacctctt acgaagtaac cgtaggctaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page