(data stored in ACNUC7421 zone)

EMBL: CR954246.PE325

CR954246.PE325       Location/Qualifiers
FT   CDS_pept        complement(353276..353479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0340"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85439"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ7"
FT                   /protein_id="CAI85439.1"
FT                   /translation="MFRRLARWWRMSTITIEGVETQEVHDLLKGMNADHAQGYLYAKPL
FT                   AYDDYLQYLNSQYNLKMLDSPF"
     ttgttcaggc gcttggcgag gtggtggagg atgtcaacaa ttactattga aggggtagaa        60
     acgcaagagg ttcacgactt acttaaaggt atgaacgccg atcacgcaca aggatacctt       120
     tacgccaaac cactcgcgta tgacgattat ttacagtact taaacagcca atataattta       180
     aaaatgttag actccccttt ttaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page