(data stored in ACNUC7421 zone)

EMBL: CR954246.PE326

CR954246.PE326       Location/Qualifiers
FT   CDS_pept        complement(353505..354671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0341"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85440"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ6"
FT                   /protein_id="CAI85440.1"
FT                   /translation="MVQYAGNCRFLWNKALAINLFKLQNKQKICYYQELDFFSKLWKKS
FT                   EEYGFLTLSPAQTIQQTLKQLERAFKDAFDKNQPLKRMPTFKKKGEVNSFNFPQGFKID
FT                   KNGKRIFLPKIGWVNVRKSQAILGKAKNVTVSQKGKHWFVSIQVEQEVAPPKHSSNAMI
FT                   GGDLGVKRLITLSDGSFVEPIDTSKQTIRIKRLQKQLARKVKFSSNWKKLKAKITTFHT
FT                   KVANIRHDKLHKISTQLSKSHAIIVLEDLKIRNMTKNSKGSSEQHGKMVKQKSGLNRVI
FT                   LNQGWGMFKEMLKYKQDWLGGQVIFVDPKHTSQTCPACGHQSKDNRLTQSKFECAKCGY
FT                   QDNADHVGALNILARGHRVLACGEIDISQLVEAGTCLMSDHKAPMVLN"
     atggtgcaat atgcgggaaa ttgtcgattc ttgtggaata aagccttagc gattaactta        60
     tttaagttac agaataaaca aaaaatttgc tactaccaag agttggattt cttttccaaa       120
     ctttggaaaa aaagcgagga gtatggcttt ttaacactat cgcccgcaca aactatccaa       180
     caaacattaa aacagcttga acgcgccttt aaagacgcat tcgataaaaa ccaaccactc       240
     aaacggatgc ctacttttaa gaaaaaagga gaggtgaata gctttaattt tcctcaaggc       300
     tttaaaatcg acaagaatgg gaaacgtatt tttttaccta aaatcggttg ggttaatgtt       360
     agaaaaagcc aagctatttt aggaaaagct aaaaacgtca ctgtttcaca aaaaggaaag       420
     cactggtttg tttcaatcca agttgaacaa gaagtagcac cacctaagca ctcatcaaac       480
     gccatgattg ggggagattt aggcgtgaaa cgcctaatta ccctttctga tggcagtttt       540
     gtggagccga tagataccag taaacagaca atcaggatca aacgattaca gaagcaactt       600
     gctagaaaag tgaaattttc aagtaactgg aaaaaattaa aagcaaagat cacaacattt       660
     catacgaaag ttgccaatat tcgtcatgac aaattacata agatctcaac acagttgagc       720
     aaaagccacg caatcatcgt gctagaagat cttaaaatta gaaatatgac gaaaaacagc       780
     aaaggcagca gtgagcagca tggaaaaatg gtgaaacaaa aatctggctt aaaccgcgtc       840
     attctcaatc aaggatgggg aatgtttaaa gaaatgctga aatataagca ggattggctc       900
     ggcggtcagg ttatttttgt tgatccgaaa cataccagtc aaacgtgtcc ggcgtgtggt       960
     catcaatcaa aagataaccg attaacgcag tctaagtttg aatgtgcgaa gtgcggttat      1020
     caagataatg cggatcatgt tggcgcatta aatattttag cgcgaggtca tcgcgttcta      1080
     gcctgtggag agattgacat tagtcagctt gttgaagcag gaacttgcct tatgagtgat      1140
     cacaaggccc cgatggtttt aaactaa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page