(data stored in ACNUC7421 zone)

EMBL: CR954246.PE328

CR954246.PE328       Location/Qualifiers
FT   CDS_pept        complement(356321..357145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0344"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85442"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC4"
FT                   /protein_id="CAI85442.1"
FT                   /translation="MKFALKSILVATIALSSAASLAHNHSENSLVANALNDEQRAAKNS
FT                   ERDKFRHPAQTLAFFGLKPNMSVVEISPGGGWYSEILAPVLKDNGKFYAAHFPKDATGF
FT                   YQRSRSEFEQKVTQDPRFSKVIVTEFAPVTHTELAPANSADMVLTFRNVHNWYMGKNKD
FT                   GALSAFKSFYTALKPGGTLGVVEHRLPEARADDDQKSSGYMKQSYVIEIAKQAGFELVA
FT                   SSEINANPKDTADHPKGVWTLPPSLRLGEQDADKYKAIGESDRMTLKFKKPL"
     atgaaatttg ctttaaaatc tatacttgtc gccactattg cgcttagctc tgcagcaagc        60
     ttggctcata accacagtga aaactcatta gttgctaatg cacttaatga tgagcagcgc       120
     gctgctaaaa acagtgagcg tgacaagttt cgtcatccag cacaaacgct ggcatttttt       180
     ggcttaaagc cgaatatgag cgtggtagaa atatcgcccg gtggtggttg gtacagcgaa       240
     attttagcgc ctgtactcaa agataatggc aaattttacg ccgcgcattt tccaaaagat       300
     gcgactggct tttatcagcg ttctcgctct gagtttgaac aaaaagtaac gcaagaccca       360
     cgctttagta aagtaatagt aactgagttt gctcctgtta ctcacaccga acttgcccct       420
     gcaaatagcg ccgatatggt acttaccttt agaaatgtgc ataactggta tatgggtaaa       480
     aataaagacg gcgcacttag tgcgtttaaa tctttttata ccgcgctcaa gccaggtggc       540
     accttaggtg tagtagagca tagattgcct gaagcacgcg ccgatgacga tcaaaaaagc       600
     agtggttaca tgaagcaaag ctacgtaatt gaaatagcta aacaagctgg gtttgaatta       660
     gttgctagta gtgaaataaa cgctaaccca aaagatacag ccgatcaccc taaaggggta       720
     tggacgctac caccaagctt acgtttaggc gagcaagatg ccgataaata taaagctatt       780
     ggtgagagtg accgcatgac gctgaaattt aaaaaaccgc tttaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page